SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431802406|ref|YP_007229309.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431802406|ref|YP_007229309.1|
Domain Number 1 Region: 5-175
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.53e-33
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|431802406|ref|YP_007229309.1|
Sequence length 177
Comment cytochrome B561 [Pseudomonas putida HB3267]
Sequence
MKTDAFHPLARLLHWLMAVLILAMLFIGVSMVADLSPRHPVLIGLHKATGLALLVLVLLR
IAVRLALPHPALPRDLPALQRWAAGASHLVLYGLMLAMPLLGWAMLSAGGYPRPLGLPAI
APHDLQLYAVLRQAHGWAGYLLFATVLVHVGAALMHAWVRRDGVLRSMWPGPLRRSQ
Download sequence
Identical sequences A0A0B5K0H3 A0A0C1KA94 A0A0P7C864 L0FKU7
WP_015270187.1.57632 WP_015270187.1.71677 WP_015270187.1.7435 WP_015270187.1.80759 WP_015270187.1.95946 gi|431802406|ref|YP_007229309.1| 2035952302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]