SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|431802621|ref|YP_007229524.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431802621|ref|YP_007229524.1|
Domain Number 1 Region: 91-296
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.43e-41
Family Phosphate binding protein-like 0.01
Further Details:      
 
Domain Number 2 Region: 6-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.04e-20
Family LysR-like transcriptional regulators 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431802621|ref|YP_007229524.1|
Sequence length 303
Comment LysR family transcriptional regulator [Pseudomonas putida HB3267]
Sequence
MEPNRFGDITAFVSAAKAGSFTAAAATLGLTRSAVGKSIARLEARMAVRLLNRTTRKLSL
TDEGLVAYERWRQILDDLDEVESTMAQRRGKPTGTLRLTAPLSFGQRHVLPILDRYLKQW
PELRADIRFTDRFVDLVEEGIDVAVRIGVPKEDSQLLTRTVAWQQFVTCASPAYLDARGV
PQVPGDLYGHDKIAFLAGEKVMPWRFHTEAGLHLCEDPGRLNIDSSEAMLAGARAGFGLI
HLPTYITGDDLRAGTLVEVLQAYRPPADPIRIVYPSKRHLSPRVRGFIDLLVASWEPGVP
WED
Download sequence
Identical sequences L0FLH6
gi|431802621|ref|YP_007229524.1| WP_015270375.1.71677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]