SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431804419|ref|YP_007231322.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431804419|ref|YP_007231322.1|
Domain Number 1 Region: 5-175
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.71e-33
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431804419|ref|YP_007231322.1|
Sequence length 177
Comment cytochrome B561 [Pseudomonas putida HB3267]
Sequence
MNSDGTVQLWDPLLRLCHWSIAVVFFANYFFNEEGEGWHQWLGYYALAVVVVRVVWGFVG
PRSARWADFWPSPASLVGHARALLHGGLDHHMGHSPIGALVMVLMLTCIAGLGLTGWASQ
EVDALFGVDWPMDLHSWLANALLVLVCVHVLAAIYESVRMRENLPWSMITGRRRHRD
Download sequence
Identical sequences A0A0N8HFQ2 A0A136QIV4 L0FN48
WP_015271788.1.57632 WP_015271788.1.71677 WP_015271788.1.95946 gi|431804419|ref|YP_007231322.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]