SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431804804|ref|YP_007231707.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431804804|ref|YP_007231707.1|
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 5.34e-40
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431804804|ref|YP_007231707.1|
Sequence length 183
Comment cytochrome B561 [Pseudomonas putida HB3267]
Sequence
MQLRNSPSRYGVVSIVLHWGVALAVFGLFGLGLWMVGLDYYSPWRKAGPDLHKSIGLVLL
AVMLLRVLWRFISPPPPAPASHGAFTRLAAKLGHLALYLGLFAVMIAGYLISTADGVGIP
VFGLFEVPALVSDLPDQADLAGVIHLWLAWGLVIFAVLHGLAALKHHFIDRDATLTRMLG
RKA
Download sequence
Identical sequences A0A0P7DBV6 A0A136QBD1 J8RY43 L0FP78
WP_003257760.1.57632 WP_003257760.1.71677 gi|431804804|ref|YP_007231707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]