SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431800100|ref|YP_007227003.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431800100|ref|YP_007227003.1|
Domain Number 1 Region: 27-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.53e-81
Family Phosphate binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|431800100|ref|YP_007227003.1|
Sequence length 309
Comment glycine betaine ABC transporter substrate-binding protein [Pseudomonas putida HB3267]
Sequence
MHKFSAAVFALALSLGTATAHAADSDAQCTTVKMADPGWSDIATTNALARVLLESLGYQV
KIDSLAVPIIYGGLKDGRVDAFLGNWMPAQQGFHDKFIANGDVQQLSRNLEGTEFTLAVP
DYVWNAGVKDFADLQKHADQFDKKLYGIGSGAPANLSLKEIIDKNEFNLGQWKLVESSEQ
AMLAQVDRAVKKQQFITFLGWTPHPMNVKLKMHYLSGGEKWFGSKGEVYTLTRKGYPQAC
PNAAKLLGNLKFTLDMENTIMAEVVDKKMSFDDAAKAWLKAHPELLEGWLAGVTTKADGN
ALEAVKAKL
Download sequence
Identical sequences L0FDM1
gi|431800100|ref|YP_007227003.1| WP_015268444.1.71677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]