SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431800271|ref|YP_007227174.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431800271|ref|YP_007227174.1|
Domain Number 1 Region: 13-262
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.24e-73
Family Phosphate binding protein-like 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431800271|ref|YP_007227174.1|
Sequence length 264
Comment cystine transporter subunit [Pseudomonas putida HB3267]
Sequence
MSKFAKPLLNASLALLLGAGLLSQAFAGEQLKTIQEKGVINVGLEGTYPPFSFQDENGKL
TGFEVELSELLAKELGVKAKVQPTKWDGILAALESKRLDVVINQVTISEERKKKYDFSEP
YTISGIQALILKKKAEQLNIHKAADLAGKKVGVGLGTNYEQWVKKDVPQADVRTYEDDPS
KFADLRNGRIDAILIDRLAALEYAQKAKDTELAGDAFSRLESGVALRKGEPELLAAINKA
LDKLKADGTLAKLSEKYFGADVTK
Download sequence
Identical sequences A0A0B5KMB8 A0A136QHX3 A0A1S2JNZ4 L0FEY1 V7DEK1
WP_015268587.1.1643 WP_015268587.1.36363 WP_015268587.1.42658 WP_015268587.1.71677 WP_015268587.1.80759 WP_015268587.1.95946 gi|431800271|ref|YP_007227174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]