SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431800346|ref|YP_007227249.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431800346|ref|YP_007227249.1|
Domain Number 1 Region: 25-301
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.51e-76
Family Phosphate binding protein-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431800346|ref|YP_007227249.1|
Sequence length 314
Comment choline ABC transporter periplasmic binding protein [Pseudomonas putida HB3267]
Sequence
MHSLIRRSLLTLALSSIATSPLFAAEPAACKNVRLGVVNWTDVIATSAMAQVLLDGLGYQ
TKQTSASQQIIFAGIRDKRLDMFLGYWNPIMTQTITPFVDAKQVKVLDKPSLEDARATLA
VPKYLADKGLKTFADIHKFEKELGGKIYGIEPGSGANTQIKAMIAKNQFGLGKFQLVESS
EAGMLAAVDRAVRRNEAVVFFGWAPHPMNVNIDMVYLGDSQDALGPDEGRATVWTVTAPD
YAERCPNAHRLLANLNFSAEDESRMMQPLLDHKDALESARQWLKDHPEDKARWLEGVTTF
DGKPAADNLKLTAN
Download sequence
Identical sequences A0A0P7D0U5 A0A136QHR4 L0FF26
gi|431800346|ref|YP_007227249.1| WP_015268643.1.1643 WP_015268643.1.57632 WP_015268643.1.71677 WP_015268643.1.95946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]