SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431800760|ref|YP_007227663.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431800760|ref|YP_007227663.1|
Domain Number 1 Region: 14-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.62e-43
Family Phosphate binding protein-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431800760|ref|YP_007227663.1|
Sequence length 284
Comment amino acid ABC transporter periplasmic amino acid-binding protein [Pseudomonas putida HB3267]
Sequence
MSQPFNVPRPFQRLLMACATFGVLASAQAASLDEIKETSHIRIGYANETPFAFTETDGRV
TGESPEIAKIIFEKMGIKQVDGVLTEWGSLIPGLRAGRFDVIAAGMYITPARCKQVIFTD
PQYALPDTLLVAQGNPKNLHSYADIARNPDVKLAIMAGTVNLAYARDSGITDAQILQVPD
TTAQLQAVRAGRADAAVGTQLTMKGLAKKGGDKVEAISDFTDDPAHTGYGALAFRPEDKA
LRDAVNAEMKKWLGSEEHLKTVAPFGFDRSNVTDKTAAELCAQQ
Download sequence
Identical sequences A0A0P7DIL9 A0A136QKB2 L0FGC4
WP_015268922.1.57632 WP_015268922.1.95946 gi|431800760|ref|YP_007227663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]