SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431800982|ref|YP_007227885.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431800982|ref|YP_007227885.1|
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.91e-64
Family Phosphate binding protein-like 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431800982|ref|YP_007227885.1|
Sequence length 211
Comment ATP phosphoribosyltransferase catalytic subunit [Pseudomonas putida HB3267]
Sequence
MLTIALSKGRILDDTLPLLAEAGIVPTENPDKSRKLIIPTTQDDVRLLIVRATDVPTYVE
HGAADLGVAGKDVLMEYGGQGLYEPLDLQIARCKLMTAGVVGAPEPKGRLRVATKFVNVA
KRYYAEQGRQVDIIKLYGSMELAPLINLADKIIDVVDTGNTLRANGLEPQELIATISSRL
VVNKASMKMQHARIQSLIDTLRGAVESRHRG
Download sequence
Identical sequences A0A059UW77 A0A099MW44 A0A0C1I1V0 A0A136QKT4 A0A1L5PJK6 F8FX66 J8VCB4 L0FF98 V7DF24 V9UUS6 V9WSC0
2035954671 gi|568180488|ref|YP_008953013.1| WP_003257924.1.15314 WP_003257924.1.1643 WP_003257924.1.23948 WP_003257924.1.28354 WP_003257924.1.32670 WP_003257924.1.33515 WP_003257924.1.35335 WP_003257924.1.35716 WP_003257924.1.41505 WP_003257924.1.52768 WP_003257924.1.56258 WP_003257924.1.57632 WP_003257924.1.59340 WP_003257924.1.61620 WP_003257924.1.65739 WP_003257924.1.71677 WP_003257924.1.7288 WP_003257924.1.7435 WP_003257924.1.76210 WP_003257924.1.76710 WP_003257924.1.78427 WP_003257924.1.80759 WP_003257924.1.92076 WP_003257924.1.9402 WP_003257924.1.95946 WP_003257924.1.99927 gi|431800982|ref|YP_007227885.1| gi|339485924|ref|YP_004700452.1| gi|568185919|ref|YP_008958442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]