SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431802131|ref|YP_007229034.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431802131|ref|YP_007229034.1|
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000105
Family Phosphate binding protein-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|431802131|ref|YP_007229034.1|
Sequence length 80
Comment LysR family transcriptional regulator [Pseudomonas putida HB3267]
Sequence
MLRQNDAAFGIWRLSRGKQSESVKVHGSLSTNDGEVALNWALDGQGILLRAGWNLADHLR
SGRLVEVLGDYQGDNLAAWH
Download sequence
Identical sequences A0A0P7CCB4 L0FK45
gi|431802131|ref|YP_007229034.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]