SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431802244|ref|YP_007229147.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431802244|ref|YP_007229147.1|
Domain Number 1 Region: 26-280
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.44e-28
Family Phosphate binding protein-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|431802244|ref|YP_007229147.1|
Sequence length 291
Comment extracellular solute-binding protein [Pseudomonas putida HB3267]
Sequence
MRLLAVLFSGLLLCCAAAQAQVRNYDAIIAAGELKVAVYKDFAPYSFEDHGQPRGVDVEL
AQALATALGVRLQLIWAPPGEKLDDDLRDYIWRGSPLRHQQLADLMMRVPYDHAYAQRRN
EVGELENAQVVMFGPYQEERWQVAYDRRRLPSVASVAVFQQHPIGVEVDSVPSFYLTSVF
NGMLSARTHHYPNVQQAFGAMQAGQVDAVMAMRGEVDWQLHQAADPQLALAENAYPNLGK
QAWEIGMAVHESNRQLAYAVEEALETLIRDGRMKAIYASYGLRYQVPEMYQ
Download sequence
Identical sequences A0A059UVI2 A0A099MXL4 L0FGY9
gi|431802244|ref|YP_007229147.1| WP_015270051.1.35335 WP_015270051.1.56258 WP_015270051.1.65739 WP_015270051.1.71677 WP_015270051.1.7288 WP_015270051.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]