SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431802276|ref|YP_007229179.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431802276|ref|YP_007229179.1|
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000000029
Family Phosphate binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|431802276|ref|YP_007229179.1|
Sequence length 66
Comment LysR family transcriptional regulator [Pseudomonas putida HB3267]
Sequence
MGISLSPQWLFKADVERGSVLSVLDDYKATALPVSAVFSRERRHSARAMAFIDFLREHLH
GLAQEP
Download sequence
Identical sequences A0A0P7CZ20 A0A136QNW4 L0FKH4
gi|431802276|ref|YP_007229179.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]