SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431803189|ref|YP_007230092.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431803189|ref|YP_007230092.1|
Domain Number 1 Region: 28-339
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.25e-70
Family Phosphate binding protein-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|431803189|ref|YP_007230092.1|
Sequence length 341
Comment extracellular solute-binding protein [Pseudomonas putida HB3267]
Sequence
MLLSKRVTAVLSASLLTLACQAAQAADSLNFVSWGGTTQDAQKEAWAVPFTKATDIKVVQ
DGPTDYGKLKAMVESGNVQWDVVDVEADFALRAASEGLLEPLDFTQIKRDKIDPRFVSDH
GVGSFFFSFVLGYNEGKLGANKPVDWTALFDTKTYPGKRALYKWPSPGVLELALLADGVA
PDKLYPLDLDRAFKKLDTIKKDIVWWGGGAQSQQLLASGEASLGQFWNGRVYALQQDGAP
VGVSWKQNLVMADFLVIPKGAKNKDAAMKFLANASSAEGQAEFANKTAYAPVNVDSVAKL
DKDLAQNLPTAYAQDQVTLDFAYWAKNGQAIAARWNEWLVK
Download sequence
Identical sequences A0A059V3H5 A0A099N2M8 A0A0C1KBZ8 A0A0M2ULS6 A0A136QGJ3 F8G478 L0FJM2 V7DBP2 V9V1G0
gi|339488173|ref|YP_004702701.1| 2035925505 WP_013973153.1.1643 WP_013973153.1.23948 WP_013973153.1.28354 WP_013973153.1.35335 WP_013973153.1.56258 WP_013973153.1.57632 WP_013973153.1.65739 WP_013973153.1.71677 WP_013973153.1.7288 WP_013973153.1.7435 WP_013973153.1.80759 WP_013973153.1.95946 WP_013973153.1.98117 gi|568188194|ref|YP_008960822.1| gi|568182816|ref|YP_008955454.1| gi|431803189|ref|YP_007230092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]