SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431803397|ref|YP_007230300.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431803397|ref|YP_007230300.1|
Domain Number 1 Region: 8-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.59e-51
Family Phosphate binding protein-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|431803397|ref|YP_007230300.1|
Sequence length 261
Comment amino acid ABC transporter periplasmic amino acid-binding protein [Pseudomonas putida HB3267]
Sequence
MKNIRSLLLAALVCGGVMSVSHAQADALADITARGVLKVAVPQDFPPFGSVGPDLKPRGL
DIDTAQLLADRLGVKLALTPVNSTNRIPFLTTGKVDLVISSLGKNPEREAVIDFSRPYAP
FYLAVFGPAETSIDNIGAVAGKTISVTRGSIEDMELSAVAPQGAVIKRFEDNNSTIAAYL
SGQVELIASGSVVMAVIAEKNPNKVPVMKVKLKDSPVYVGLAKQEPALLEKVNATLNAAK
ADGSLDRNAEKWLKQPLPADL
Download sequence
Identical sequences A0A0P7D8X3 A0A136QG27 F8G664 L0FM34 V9V3H2
gi|568182973|ref|YP_008955620.1| WP_013973355.1.1643 WP_013973355.1.23948 WP_013973355.1.28354 WP_013973355.1.56258 WP_013973355.1.57632 WP_013973355.1.71677 WP_013973355.1.7288 WP_013973355.1.95946 gi|339488384|ref|YP_004702912.1| gi|568188351|ref|YP_008960988.1| 2035995115 gi|431803397|ref|YP_007230300.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]