SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431804845|ref|YP_007231748.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431804845|ref|YP_007231748.1|
Domain Number 1 Region: 8-258
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.93e-64
Family Phosphate binding protein-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|431804845|ref|YP_007231748.1|
Sequence length 266
Comment amino acid ABC transporter periplasmic amino acid-binding protein [Pseudomonas putida HB3267]
Sequence
MIKKYLSRLLVGVTALVAVTAAQAGAIDDAVKRGTLRVGMDPTYMPFQMTNKRGEIIGFE
VDILKAMAKSMGVKFEPVSTAYDGIIPALLTDKFDMIGSGMTLTQERNLRLNFSEPFIVV
GQTLLIRKELAGEIKSYKDLNNEKYRITSKLGTTGEMVSKKLIAKAKYHGYDNEQEAVMD
VVNGKADAFVYDAPYNVVAVDKAGAGKLLFLEEPFTYEPLAFGLKKGDYDSINFINNFLH
QIKHDGTYDRIHDKWFKNKDWLKEME
Download sequence
Identical sequences A0A059V3N8 A0A0B5K8Z4 A0A1L5PX91 L0FT17 V7DES8
gi|431804845|ref|YP_007231748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]