SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431804961|ref|YP_007231864.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431804961|ref|YP_007231864.1|
Domain Number 1 Region: 21-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.62e-68
Family Phosphate binding protein-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|431804961|ref|YP_007231864.1|
Sequence length 341
Comment ABC transporter substrate-binding protein [Pseudomonas putida HB3267]
Sequence
MYKHLALAAAVSAVFSLQASAAGTQLTVYTALEAEQLKSYKQAFEKANPDIEIKWVRDST
GIITAKLLAEKDRPQADAVWGLAASSLAILDQNGMLEAYAPKDLGKIAANYRDAANPPAW
VGMDVWAATICFNTIEAEKQGLSKPVSWQDLTKPEYKGKIVMPNPASSGTGFLDVSAWLQ
TFGEPQGWAYMDALHQNIGQYVHSGSKPCKLAAAGEFPIGISFEYPAVQLKRQGAPLDIV
LPKEGLGWEIEATAVIKGSPKADAARRLADFSASPAAMELYKENFAVLAAPGIAKPQTEL
PADYEQRLIKNDFAWASKNRDQILAEWRKRYDGKSEKVAQQ
Download sequence
Identical sequences A0A0B5KKH0 A0A0C1I3M3 A0A0P7D455 L0FT45
WP_015272178.1.57632 WP_015272178.1.71677 WP_015272178.1.7435 WP_015272178.1.80759 WP_015272178.1.95946 gi|431804961|ref|YP_007231864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]