SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|431804992|ref|YP_007231895.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431804992|ref|YP_007231895.1|
Domain Number 1 Region: 9-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.74e-63
Family Phosphate binding protein-like 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|431804992|ref|YP_007231895.1|
Sequence length 290
Comment extracellular solute-binding protein [Pseudomonas putida HB3267]
Sequence
MKTANLTKLLAPLFGLALLAGCNKAEEPPKPAAASPATSYLETIKARDKLIVGVFTDKPP
FGFVDEQGRYVGFDTDIGRRLAKDLLGDENKVEFVAVEPASRIPFLQSDKVDLILANMTV
TPERKEAVDFTNPNLRVAVQAIVADGSPVQKLDDLADKTIIVTTGTTADIWLTKNHPDWK
LLKFEKNSESLQALATGRGDAYAQDNLILFSWAKQNPGYRVLPELLGDEAPIAPAVKKGN
TELRDWVNAELAKLGEEKFLLKLYDQYVRKELSDDTKPESVIVEGGKWQG
Download sequence
Identical sequences A0A0N8HE48 A0A136QDS4 A0A1L5PXT2 L0FRN6
WP_015272203.1.32670 WP_015272203.1.52768 WP_015272203.1.57632 WP_015272203.1.59340 WP_015272203.1.61620 WP_015272203.1.71677 WP_015272203.1.76710 WP_015272203.1.92076 WP_015272203.1.9402 WP_015272203.1.95946 WP_015272203.1.99927 gi|431804992|ref|YP_007231895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]