SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431805215|ref|YP_007232118.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431805215|ref|YP_007232118.1|
Domain Number 1 Region: 27-366
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.02e-101
Family Phosphate binding protein-like 0.00000000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431805215|ref|YP_007232118.1|
Sequence length 367
Comment putative ABC transporter periplasmic polyamine-binding protein [Pseudomonas putida HB3267]
Sequence
MVRLKRLLAPFIAATLFTGALQAQTEQRTLRVFNWFDYITPQTLTEFQKDSGVKLVYDIF
DTNEALEAKLLTGNSGYDVVVPSNVFLAKQIEAGVFQPLDRSKLPNWQHLDPALMKLIEA
NDPGNKFAVPYMYGTVLIGFNPAKVKAALGENAPVDSWDLIFKEENIAKLKQCGVALLDS
PSEIMPLALQYLGLPPNSDKPADYKKAEALMLKIRPHITYFHSSKYMADIANGDICVAVG
YSGSFSQAANRAREAKNGVVVDMRLPKEGAPIWFDMLAIPKNATNPEDAHAFINYLLRPE
VIAPISDFVGYPNPNKDATDKVDPAIRNNPNLYPTAEAMAKLYTLKPLARDAERARTRAW
TRIKSGT
Download sequence
Identical sequences A0A0P7DS57 L0FU29
gi|431805215|ref|YP_007232118.1| WP_015272359.1.57632 WP_015272359.1.71677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]