SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340781079|ref|YP_004747686.1| from Acidithiobacillus caldus SM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340781079|ref|YP_004747686.1|
Domain Number 1 Region: 6-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.16e-90
Family Methylenetetrahydrofolate reductase 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340781079|ref|YP_004747686.1|
Sequence length 276
Comment 5,10-methylenetetrahydrofolate reductase [Acidithiobacillus caldus SM-1]
Sequence
MATRCEFSVEFFPPKNPAGEAKLRETIGALQALRPDYASVTYGAAGSTQEPTLATVAMLA
RDTELEAVPHLTCIGSTEAGIRAILEHYRELGIRRIVALRGDLPPDREDPGFFHQALDLI
AYIRAFGGFQIYAAAYPEFHPRAVHARADLEYLQRKVEAGASGLITQYFYNPDAYLQLRD
DLARRGVDVPITVGVMPMTNYAQIANFSAQCGAEIPQFLRRRMESFADDPGAQAELAIEV
ASRQCRLLLDQGAPGLHFYTLNQAEATLAIARNLGL
Download sequence
Identical sequences A0A2I8YQH6 F9ZPE0
WP_014002238.1.38903 WP_014002238.1.41243 gi|340781079|ref|YP_004747686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]