SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340781474|ref|YP_004748081.1| from Acidithiobacillus caldus SM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340781474|ref|YP_004748081.1|
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.71e-22
Family Frataxin-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340781474|ref|YP_004748081.1|
Sequence length 105
Comment iron donor protein CyaY [Acidithiobacillus caldus SM-1]
Sequence
MSDETFALSAERTLEQILGQLEGNAPEVEADLVDSVLTLELPDSSTIVLNRQEAVEQIWL
ACSDGPARFQHTDRGWRDTQTDQELGEVLGTLIGRRLGRTLQIRL
Download sequence
Identical sequences A0A059ZSL0 A0A1E7YU09 F9ZMJ2
gi|340781474|ref|YP_004748081.1| WP_004870992.1.100361 WP_004870992.1.38903 WP_004870992.1.41243 WP_004870992.1.50163 WP_004870992.1.58346 WP_004870992.1.8941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]