SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340781602|ref|YP_004748209.1| from Acidithiobacillus caldus SM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340781602|ref|YP_004748209.1|
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.41e-48
Family PP-loop ATPase 0.00012
Further Details:      
 
Domain Number 2 Region: 340-411
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000549
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0048
Further Details:      
 
Domain Number 3 Region: 226-298
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000144
Family MesJ substrate recognition domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340781602|ref|YP_004748209.1|
Sequence length 441
Comment tRNA(Ile)-lysidine synthetase [Acidithiobacillus caldus SM-1]
Sequence
MILAFSGGRDSTALFWALHAIGQDFVAAHVDHGWHPRSAEWAARCAEVAASAGVPFVLRQ
LGKDLCGEGPEDVARRGRYAALQSLLGPGQFLLTAQHRDDQAETFLLQALRGAGAAGLAA
MPWRRPLGSGVLARPLLDCSGQTLQGYLHRRGLQWIEDPANRDPRFARSRVRRQFIPALV
RCGWSDPATPIARSAANLADTLQVEADWFRRMWRDYCRACPEKGAEPRLSLAFLRTLPES
LHRVFLRQYLRHRRLSPPNHEDLQTLLARTAQPAHGQRLAWPGVEAWVQGGWLWLWPADL
HWGEGGPQGTWWPQAPEGVGSGFAWSFGGEAPAATRLHRLDPAVLARPLRWERPQPGMRY
VDAAGHHRPLKKLLLEAGVPPFLRPQLPLLWDARDRLLLMLGFPRDKGLGETADGPLRLW
PKPNDQWDFSLKFEEPGLGVR
Download sequence
Identical sequences A0A059ZSX8 F9ZM27
gi|340781602|ref|YP_004748209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]