SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340782088|ref|YP_004748695.1| from Acidithiobacillus caldus SM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340782088|ref|YP_004748695.1|
Domain Number 1 Region: 183-447
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 6.54e-27
Family Nitrous oxide reductase, N-terminal domain 0.038
Further Details:      
 
Domain Number 2 Region: 558-839
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.00000102
Family Arylsulfatase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340782088|ref|YP_004748695.1|
Sequence length 973
Comment cell surface antigen SLP4 [Acidithiobacillus caldus SM-1]
Sequence
MKAWTKGGHWMYRRPFSRRPAALLAGVVAILTTATPMAFADPALVAQPMQITAANRSEFT
GILPTWRRVTPVGTVVSTPNFPTQVAVAGDRIGVLANGATPFQTITWFDPHLQRLARFAA
LSKPVPPKPVAFATPGGTAIAIDPEHTGAAGTAYATAQTASVLQKEAEDSLKAESNPQAV
ATTTLGKADLFQGLVAGPDGRWYATGGAADAVYALQVHAGKVTVLRSYPLHWQSFPKSQY
PYVYQGNHRQKPWLFYPDSVVLGPHDKHLYVTGMLANSLARIDLVSGKTDYLNVGPYPFA
VVLADQGKRLVISDWAGDGVTVVDRQGFRVLGRVRTAPPLGPHSRAAGAHPTAMVAAADG
PDVWVADANSDAVVEIDSETLKPVRVLADSPYPDAPPGSYPDALALSDGKLFVANAGNDD
VAVFAAKSGKLEGLIPTAWYPTALAVHGHYLYITAGKGFGTGPNLQWQYIGNMMHGLLQR
VDLDELPEKLGHWTDLALADDGFSAAQRQALAEQNAKTTDFLRRHIHYVVFILRENKTFD
EDFGDYRAAGSWADPHFDLYGPKELPNLYHWAAHNVLFANFMADGEVTAQGHQWTDGASD
SDVVQRLWPEYYSSRGLLWNAGPGGSSSLSPGAPGSHDPYQYNRRSLGHYTNPWMSYPER
LYLFNDLLAHGVSFEDFGENLSRSRDGVIRKALLAHVDATYPGWDRMLLDGTRVKAAIRW
LRAHSGTRFPHFIFIWIPDDHTAGLAPCYYSPDYYVADNDHATAQLLHYLASTPQWRHMA
VFLTEDDAQSGADHIDAHRTFALAMGPWVKGGDLDTAPLSQVNIVRTIEATFGLPPMSQW
DANAEVISGIWRDRPRKDPMPVLPMQVAVQFNAGKCSRRLLLRREAGATGNLPTAAWLKA
HTDPHGATVALAASASYTPTSLLRVPGPEQLRQEWIASKGQRSYRDFEAYLRQYAAAHGT
TVASFEANEGKLQ
Download sequence
Identical sequences A0A1E7YLA9 F9ZNZ8
WP_014002835.1.38903 WP_014002835.1.41243 WP_014002835.1.58346 WP_014002835.1.8941 gi|340782088|ref|YP_004748695.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]