SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340782951|ref|YP_004749558.1| from Acidithiobacillus caldus SM-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|340782951|ref|YP_004749558.1|
Domain Number - Region: 29-68
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.068
Family Frataxin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340782951|ref|YP_004749558.1|
Sequence length 516
Comment Fibronectin/fibrinogen-binding protein [Acidithiobacillus caldus SM-1]
Sequence
MSPVRDPVLSMDALQLWTAASCIAPLVEGAALREAKLGAGWLRLCFGTRTSLVIAQQRAP
LGLWLADPCPQSRVGHPVALGQLLRGFLLQRIDVPWGDRILRLSWERVTITKERQHRHLI
AECFGGRGNLAVTDADDSILWAWRWDRLDSREMRFLPGHRYASPARGRAATRPFADTLSE
PLQLLGPRARSEAEDGCLEPARLDQALVDRWAKPSGDWYQWRSQDGSRIRYPLRLRGSAT
TIPALQALRLEAPPWEQDAENRPDPNALQRQRLDRLKQRMARVREDLIRWQRVPDTVQRD
AEALFQMPDAVHPGGALEVPDYRSYGIGRRTVSVPAGYRLHDYARHLIKQRQRAQRGREA
CSERLRQLEEEHARLLQASLTDVPATPEKPGRRRQPQGLAPAIESREIDGFQILWGRNAK
ANDHLTFRLAQPWDLWFHVQDQPGSHVLLRRPRDRPVPEKVLDAAAQLALQFSSVQTKSA
DVDWTEARHIKRHPNGAPGRVLYRHFHTRRVRRVGS
Download sequence
Identical sequences A0A060A187 A0A1E7YS33 F9ZRL0
WP_004868317.1.100361 WP_004868317.1.38903 WP_004868317.1.41243 WP_004868317.1.50163 WP_004868317.1.58346 WP_004868317.1.8941 gi|340782951|ref|YP_004749558.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]