SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340783270|ref|YP_004749877.1| from Acidithiobacillus caldus SM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340783270|ref|YP_004749877.1|
Domain Number 1 Region: 5-142
Classification Level Classification E-value
Superfamily PEBP-like 1.57e-23
Family Prokaryotic PEBP-like proteins 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340783270|ref|YP_004749877.1|
Sequence length 185
Comment hypothetical protein Atc_2528 [Acidithiobacillus caldus SM-1]
Sequence
MAVEMKVFSTGIDPQDWIPERFTKPGGGVTPPIFWQHLPEKTRSLVLLMEHREAKPEARV
FWLVYDIPPKAEGIHEGGPLPAGAKVGRNSFGEVGYRPPEASADRSLQHYDFLLLATDLA
SLGLPEGADWEAVKQALKGHHAPEDLAPPPAIDVRARELHPLSHVLDHAEFSGHFALDID
APAKT
Download sequence
Identical sequences A0A059ZXM7 A0A1E7YT17 F9ZSG5
WP_004868897.1.100361 WP_004868897.1.38903 WP_004868897.1.41243 WP_004868897.1.50163 WP_004868897.1.58346 WP_004868897.1.8941 gi|340783270|ref|YP_004749877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]