SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340783300|ref|YP_004749907.1| from Acidithiobacillus caldus SM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340783300|ref|YP_004749907.1|
Domain Number 1 Region: 212-401
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.71e-54
Family B3/B4 domain of PheRS, PheT 0.0000574
Further Details:      
 
Domain Number 2 Region: 474-688
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.52e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 3 Region: 40-196
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.92e-40
Family Myf domain 0.0022
Further Details:      
 
Domain Number 4 Region: 695-793
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.57e-21
Family Anticodon-binding domain of PheRS 0.00079
Further Details:      
 
Domain Number 5 Region: 410-482
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.06e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340783300|ref|YP_004749907.1|
Sequence length 796
Comment Phenylalanyl-tRNA synthetase subunit beta [Acidithiobacillus caldus SM-1]
Sequence
MQISIQWLREAWLDSSWSTQRLAESLTMGGIEVEAIDRAASPLPGVVVAAVRTVRSHPQA
EKLRIAEVDAGDGRLRQVVCGAANLRPGQCVPLALPGALLPGDVHIQETELRGVRSEGML
CSAAELNLADGSSGLLELDAQAPLGHALYDYLRLDDEILTLGITPNRGDAFSYLGIARDL
SALGAGMLRAWQPQAVSWAQQAQRAPLGERLQIAVEPAAAQACPRYHALLLEDLPTRLPD
HLRERLRRSGQRQVAPVVDWLNLQMLALGQPMHAFDADQIRGGLTVRWARSGEILDALDG
RDRILESDMLVIADDEGPVALAGIIGGRRTAVQDDTRRIVLESAYFQAKAVQGRARRLGL
QTEAAMRFERGVDFRLGLPAAVATWQSMAHHARVTVLASAMVANAEPDLPWIPLRSQRVA
RILGFAPPAERIREILSALGCSVEAQGEGSWRVQPPSHRYDLRIEADLIEEIARISGYDQ
LPQRQPLGLLAPHPLAPEPRAEALRAFLVARDYHEVITYSFISAEAQARFCPDDEPVALR
NPLSNDLAVLRGSLWPGLLQALQFNVNRQQERVRLFEMGRIFTGAQQRLQLAGVIHGPAL
PEHWSGPSPWCDFYDLRGDVEGLLRHWQTLDLEYRRSCNPNLHPGQSADLWLDGSLLGSI
GALRPNLHERYELDKAAFLFYLDLEALAKHGKSVHFQPIPSQPGLRRDLALIVPEGISAG
QVLRTVREAASRAVREHWIFDRYQGSQVAPGHYGLGVGLLLQEDDRTLTESEVQGELERI
LAALRTLGSIQLRIQG
Download sequence
Identical sequences A0A2I8YW29 F9ZSM0
WP_014003487.1.38903 WP_014003487.1.41243 gi|340783300|ref|YP_004749907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]