SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340783185|ref|YP_004749792.1| from Acidithiobacillus caldus SM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340783185|ref|YP_004749792.1|
Domain Number 1 Region: 453-563
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340783185|ref|YP_004749792.1|
Sequence length 600
Comment sulfate transporter [Acidithiobacillus caldus SM-1]
Sequence
MSRTMSVNPLWLFQIFPWLRWWPRVGRDSLRADLIAGLTGAIIVLPQGVAFAVIAGLPPE
YGLYTAMVPAVIAALFGSSWHLVSGPTTAISIVVFGALSVMAEPGTAHYIELALTLTFLT
GLFQLAMGVARLGAVVNFISHTVVVGFTAGAAILIASSQIKNFFGVDLPRGAGFAETIWT
FAHRLQEINPYVLAVAMVTLLTGILIRRYAPRVPYMIAAMLAGSLVAFLLNHFLGDSRTG
IRLLGALPARLPPLSLPDFDPKALSQLAPAALAVAMLGLTEAVSIARAVAARAEQRIDGN
QEFIGQGLSNVVGSFFSAYASSGSFNRSGLNYEAGARTPLAAVFASVALGAILLLVAPLM
AFLPIASMAAVLFLVAYGLIDFHHIRGILRASKRETAILLTTFLSTLFVQLEFAIYLGVM
LSLIFYLLRTSKPNVASVTPDPESPYRPLVARLDLPQCPQVLMVRIDGSLFFGAVNHVEQ
RLGELAQQFPERRVLVINGRSINFVDIAGAETLVQEARRWRRRGGDLYIYGLKPAAMAIL
ERGHFLDELGRDRVLNNRDEVIRRLYPDLDPEICARCTARIFTECRQGESKVHRLTSAGT
Download sequence
Identical sequences A0A059ZTH1 A0A1E7YJ83 F9ZRS5
WP_004868723.1.100361 WP_004868723.1.38903 WP_004868723.1.41243 WP_004868723.1.50163 WP_004868723.1.58346 WP_004868723.1.8941 gi|340783185|ref|YP_004749792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]