SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344198869|ref|YP_004783195.1| from Acidithiobacillus ferrivorans SS3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344198869|ref|YP_004783195.1|
Domain Number 1 Region: 98-399
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 1.26e-25
Family Nitrous oxide reductase, N-terminal domain 0.037
Further Details:      
 
Domain Number 2 Region: 512-616,651-798
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.0000733
Family Arylsulfatase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344198869|ref|YP_004783195.1|
Sequence length 937
Comment SMP-30/gluconolaconase/LRE-like region-containing protein [Acidithiobacillus ferrivorans SS3]
Sequence
MEKGCLNLSVCFFMLFLNIFCADDAWSAGVSPLNTRNIKGPIHVSAENKGRVTHILPTGR
IVSPVGLVNGAPNFVTAVVPVGNHVAAMANGATRAQTITLYDQKTLERVAEIAAYKKDAK
KAAPRPNDLTDLHGETIAHQSFFQGMVAGADQTIYAAGGESGDVAAFALRGGKPTLLRRY
PLTWQAFPKGQYPYEYQGHHINQPRLFYPDAVAVGPHGKHLYVTGMLSNSLARVNIQSGQ
TDYLNVGPYPYAVTFADGGQKLVVSLWGGNGVAVIDPVTMELLGTVRVGPPPGPDNTAAG
VHPTALAAVPQSPDVFVALANVDRVAEVDTINLSVKRFLNDRPYHDAPPGSYPDGLTIAD
GKLFVANAGNNDVAVYNAQTGKGLGLIPTGWYPTAITHVGNALYVVGAKGLGSGPNVDHQ
WVGDMMGGLIQKIDLNDLSTHLPAWTRKSLRNDGFTAAQRHVRHAEDVKTTAFLRKHIHY
VVFILRENKTFDEDLGDYQRAGAWAEPRLDLYGPKDLPNLYHLARHNTLFVNFMADGEVT
AQGHQWTTAASDSDFVQRTWPEYYSGRGLVPNPGWTQSLLPGGASGTGGIPLGVDNPYAI
YENLSVLGKWSNPWISYPQRLFLFNDLLDHKVSFEDFGEFVSRSQAGNISTAMKKHLATG
FPGWDRMMLDTYREKMAVRWLQAHPGAQFPHFIYIWLPDDHTAGRSPCYYTPNYYVANND
YATAKFIHYLSTTPEWKHMVVFLTEDDAQSGADHLNAHRTFALAVGPWVRRDYLETHLYS
QVNMLKTTEAILGLPPMSQWDENAGVFSGMWTHHPDYAETRLLPMQVPVAFNAGQCDDYT
LMRREAGASGHPLRPDSKWYIWYKAHQAQHGAGLPPPGKGEAYAPTTLLKVPGPEQMKQE
WIATKGVKAWHKEVAYLKAYAQKRHAPIAAYQAGETE
Download sequence
Identical sequences G0JLB7
gi|344198869|ref|YP_004783195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]