SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344199096|ref|YP_004783422.1| from Acidithiobacillus ferrivorans SS3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344199096|ref|YP_004783422.1|
Domain Number 1 Region: 21-154
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.66e-25
Family MJ1460-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344199096|ref|YP_004783422.1|
Sequence length 157
Comment 4-vinyl reductase 4VR [Acidithiobacillus ferrivorans SS3]
Sequence
MTIETNLFEKIDFANATKVVRPTLGNEAPIALFRLVRLILLEDMFGVSSTAQAYLSGRHL
GYSLGLKDLSQFVELCEQLKIGVIKTGENDKGQLHIDVYECVTCSGMEPVGRTLCSFEGG
LIAGVAEGIFKNKVNVREVTCIGGLGHESCGFDVIQK
Download sequence
Identical sequences A0A060URN6 G0JMZ1
gi|344199096|ref|YP_004783422.1| WP_014028355.1.5719 WP_014028355.1.7011 WP_014028355.1.78061 WP_014028355.1.89598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]