SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344199470|ref|YP_004783796.1| from Acidithiobacillus ferrivorans SS3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344199470|ref|YP_004783796.1|
Domain Number 1 Region: 29-230
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.26e-52
Family PP-loop ATPase 0.0000896
Further Details:      
 
Domain Number 2 Region: 343-447
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000000968
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 253-315
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000902
Family MesJ substrate recognition domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344199470|ref|YP_004783796.1|
Sequence length 464
Comment tRNA(Ile)-lysidine synthase [Acidithiobacillus ferrivorans SS3]
Sequence
MESSAPPELERRLQTRLQGSLRPPEGRILYMAYSGGGDSTALLAALVSLGYTVHALHVDH
GWHPDSAQWAQSCQQQAAALGVAFTLLHLPPDTPGEGPEDQARRARYALMAAQLGQGDWL
LTAQHLEDQAETLLLQLLRGAGVAGLAAMPWQRPLGAGLLIRPLLDVPQQVLRDYLEQWH
LPFLNDPANADMRYDRVRVRNILLPQLRDMGWPHAAPNIARAADNLADMREIAADWFTLR
WQQYRTDYPELSAEQLALEYLQSLSAAAQRVFLRGWLQQRQIPVPSRERLEALRDAVMQR
RGGARIQWEGGQAWLQGGLLRAWPQPRMMAEKEWEEGPWCAAQGDPLPIPGWQYALRDTP
PEGFHHALAERFAETVVYWRRRREGELTLTGQGQHRPLKKLLLEAGVPPDRRAGVPLLWD
EAGHLLLILGYYTAPWACAPYKSRVLCLWNAGVQSSASSGVGST
Download sequence
Identical sequences A0A1E7XWA3 G0JQD9
WP_014028727.1.78061 gi|344199470|ref|YP_004783796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]