SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344199919|ref|YP_004784245.1| from Acidithiobacillus ferrivorans SS3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344199919|ref|YP_004784245.1|
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 6.15e-44
Family Molybdopterin synthase subunit MoaE 0.0000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|344199919|ref|YP_004784245.1|
Sequence length 161
Comment molybdopterin biosynthesis MoaE protein [Acidithiobacillus ferrivorans SS3]
Sequence
MIIKVQQEDFEPMAEMAAYPVDAIAGAGGSVTFIGTVRDYSEAADILAMEIEHYPGMTER
ELERISAEAARRYDILDSLIIHRYGHLAPQDNIVMVAVWSRHRAAAFDACRFLMDVLKTS
APFWKKEITLAGVRWVTDCPGCRAGGREGHTHVPYSHVHTS
Download sequence
Identical sequences A0A1E7XSG4 G0JU67
gi|344199919|ref|YP_004784245.1| WP_014029174.1.78061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]