SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344200516|ref|YP_004784842.1| from Acidithiobacillus ferrivorans SS3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344200516|ref|YP_004784842.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 7.85e-114
Family UbiD middle domain-like 0.00000000185
Further Details:      
 
Domain Number 2 Region: 323-483
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 3.66e-63
Family UbiD C-terminal domain-like 0.000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344200516|ref|YP_004784842.1|
Sequence length 490
Comment UbiD family decarboxylase [Acidithiobacillus ferrivorans SS3]
Sequence
MSYRDLRAFMADLEKRDLLRRLNIPVSPALEMTEICDRSLRAAGPAILFTQPAGYDMPVL
GNLFGTTERVALGMGGESLADLRQIGQLLAYLKEPDPPRGLRDLWEKLPTLRKILYMAPT
TMSRPPCQETVRRGAAVDLAAFPVQTCWPEDAAPLMTWGLTITKGPHKRRANMGIYRQQV
IGRNRVIMRWLAHRGGAQDLREFQKAHPGEAFPVAVAYGADPATILAAVIPIPDAISEHQ
FAGLLRGGRTELANALSVPLQVPARAEIVLEGHIYPDDMAVEGPFGDHTGYYNETERFPV
FTVETISHRENPVYHSTYTGRPPDEPAILGAALNEVFVPLLQKQFPEIVDFYLPPEGCSY
RLAVVSIRKGYPGHAKRIMFGIWGFLRQFMYTKFIIVVDEDINVRRWEDVIWAMTTRMDP
VRDITLIENTPIDYLDFASPVAGLGGKLGMDATNKLPGETAREWGRPIHMPDGLRKRVDD
LLATLERPLF
Download sequence
Identical sequences A0A1E7XR34 G0JPH5
WP_014029766.1.78061 gi|344200516|ref|YP_004784842.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]