SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478482976|ref|YP_007713626.1| from Candidatus Methanomethylophilus alvus Mx1201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478482976|ref|YP_007713626.1|
Domain Number 1 Region: 73-135
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000222
Family NfeD domain-like 0.0066
Further Details:      
 
Weak hits

Sequence:  gi|478482976|ref|YP_007713626.1|
Domain Number - Region: 17-78
Classification Level Classification E-value
Superfamily Respiratory nitrate reductase 1 gamma chain 0.0392
Family Respiratory nitrate reductase 1 gamma chain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478482976|ref|YP_007713626.1|
Sequence length 137
Comment hypothetical protein MMALV_09660 [Candidatus Methanomethylophilus alvus Mx1201]
Sequence
MILGLVVLTVEAFFPGGYLLIPGAILVIVGAYGYAAPDNFYTMWTPVVAIISAVPVTAAT
VFLYKRLGSPEVPSTTVSDSLIGKEGTVVVGISPGNIKGKVKIGSDTWSAEADEDIPAGT
AVVVDHSEGVHVHVVRK
Download sequence
Identical sequences M9SJK9
WP_015504849.1.58722 gi|478482976|ref|YP_007713626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]