SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478482988|ref|YP_007713638.1| from Candidatus Methanomethylophilus alvus Mx1201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478482988|ref|YP_007713638.1|
Domain Number 1 Region: 4-179
Classification Level Classification E-value
Superfamily LigT-like 1.43e-33
Family 2'-5' RNA ligase LigT 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478482988|ref|YP_007713638.1|
Sequence length 180
Comment 2'-5' RNA ligase [Candidatus Methanomethylophilus alvus Mx1201]
Sequence
MDVRTFVSIPIPNTSGLDPFMRDLKGIRGIKPSPTAQMHITLKFIGDIPEEKVDVVEECV
LKSVSGISKGRISVKGTGAFPNQKAPRIIWAGVETSLPLEKMSADIGSRLEAEGIPFDTK
PFKPHITVARVEGRPDISRILHNYSATEFASFICPAVLIMKSELSPKGATHTIMRMCELR
Download sequence
Identical sequences M9SD91 R7Q153
gi|478482988|ref|YP_007713638.1| WP_015504861.1.58722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]