SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478483343|ref|YP_007713993.1| from Candidatus Methanomethylophilus alvus Mx1201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478483343|ref|YP_007713993.1|
Domain Number 1 Region: 15-126
Classification Level Classification E-value
Superfamily GlnB-like 6.35e-32
Family Prokaryotic signal transducing protein 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478483343|ref|YP_007713993.1|
Sequence length 129
Comment hypothetical protein MMALV_13400 [Candidatus Methanomethylophilus alvus Mx1201]
Sequence
MADAPIARKAAAGTLKKVVIITRREMLGALKSQMDGLGISGMTISYVEGFGAQKGHTQTY
RGVHVDSALLPKMKAEIVASKIPVQDVVEAAKRAIHTGAVGDGKIFTYDVENAFRIRTGQ
SGADAVSAE
Download sequence
Identical sequences M9SED7
gi|478483343|ref|YP_007713993.1| WP_015505216.1.58722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]