SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478483434|ref|YP_007714084.1| from Candidatus Methanomethylophilus alvus Mx1201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478483434|ref|YP_007714084.1|
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily GlnB-like 4.77e-34
Family Prokaryotic signal transducing protein 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478483434|ref|YP_007714084.1|
Sequence length 120
Comment Nitrogen regulatory protein P-II [Candidatus Methanomethylophilus alvus Mx1201]
Sequence
MKMVVAIVRPEKYGEVKDALKDRGVTGMTFTPVTGRGMQAGVKFTNRVGEFMIDEIEKVK
IEIVVEDDSKVPCVIDTICQAAKTGRHGDGRIFVLPVESAVRISEWEPEPMKEAQNTEGN
Download sequence
Identical sequences M9SFG5
WP_015505306.1.58722 gi|478483434|ref|YP_007714084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]