SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410023747|ref|YP_006893000.1| from Helicobacter pylori Rif1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410023747|ref|YP_006893000.1|
Domain Number 1 Region: 57-149
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 9.94e-21
Family Ribosomal protein L9 C-domain 0.00049
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.29e-16
Family Ribosomal protein L9 N-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410023747|ref|YP_006893000.1|
Sequence length 149
Comment 50S ribosomal protein L9 [Helicobacter pylori Rif1]
Sequence
MKVLLLEDVKNLGKAGEVCEVKDGYGNNFLIANQKAKLATNEVINKYKAEVKKKAEKEAL
EKAQKLQMVETLQTITLTIHKKVGANGSLFGAITKEEITERLKEQHASLNLDKKDIELKH
PIKSTGIYEIEVKLGSGVVGVFKIDVVAE
Download sequence
Identical sequences A0A1Y3E2W0 A0A293UPP0 E1PYZ6 P56035 T2T519
gi|410023747|ref|YP_006893000.1| gi|308184321|ref|YP_003928454.1| gi|410501514|ref|YP_006936041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]