SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387125109|ref|YP_006290991.1| from Acinetobacter baumannii MDR-TJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387125109|ref|YP_006290991.1|
Domain Number 1 Region: 14-403
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 6.15e-140
Family ArgJ-like 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387125109|ref|YP_006290991.1|
Sequence length 406
Comment glutamate N-acetyltransferase/amino-acid acetyltransferase [Acinetobacter baumannii MDR-TJ]
Sequence
MAVGDVTMPQMHVVKGVKIGSTEAYVRYPNRRDLVIFEFAEGSNVAGVFTQNAFCAAPVH
VSKAHLAEGNPRYLVINTGNANAGTGPTGLKNAQDTCAKLAELAGVNSFEVLPFSTGVIG
EQLPMERLLAGLQPALNSVQDAAWSDAASGIMTTDTVPKGASEQFELDGMTYTMTGISKG
AGMIRPNMATMLSFVATDAPIRRDLVQKLLKTTVEHSFNRITIDGDTSTNDSCIFVATGQ
AGGAEITSESDVRYAKVLEVLARVMNRLAQLIVRDGEGATKFITVAVEGGANTQECCDIA
YSIAHSPLVKTALFASDPNWGRILAAIGYAGVKDLDVSKIQVWLDDVQICKDGGAAEDYT
EEAGARVMAQTEITIRVDLGRGQAKDTVYTCDLSYDYVKINADYRS
Download sequence
Identical sequences A0A009G061 A0A009JPY6 A0A009S2V4 A0A059ZR93 A0A062EV60 A0A062IGW3 A0A062MJX1 A0A0E1PU19 A0A0J1A017 A0A0R1BZY2 A0A158LPR2 A0A171EJK3 A0A2K2YG41 B0V7S0 B0VUP2 G2JKX6 N8ZBQ5 N9KM95
gi|407931582|ref|YP_006847225.1| gi|215484558|ref|YP_002326793.1| gi|169797095|ref|YP_001714888.1| gi|387125109|ref|YP_006290991.1| 405416.ACICU_00657 480119.AB57_0761 509170.ABSDF2808 509173.ABAYE3105 557600.ABBFA_002905 WP_000268130.1.100119 WP_000268130.1.100136 WP_000268130.1.100152 WP_000268130.1.100157 WP_000268130.1.100211 WP_000268130.1.100222 WP_000268130.1.100238 WP_000268130.1.100290 WP_000268130.1.1003 WP_000268130.1.100380 WP_000268130.1.100406 WP_000268130.1.100568 WP_000268130.1.10058 WP_000268130.1.100616 WP_000268130.1.100656 WP_000268130.1.100957 WP_000268130.1.100971 WP_000268130.1.101001 WP_000268130.1.101005 WP_000268130.1.101012 WP_000268130.1.101037 WP_000268130.1.101100 WP_000268130.1.101243 WP_000268130.1.101254 WP_000268130.1.101276 WP_000268130.1.101338 WP_000268130.1.10136 WP_000268130.1.1014 WP_000268130.1.101409 WP_000268130.1.101413 WP_000268130.1.10147 WP_000268130.1.101515 WP_000268130.1.101574 WP_000268130.1.101742 WP_000268130.1.101810 WP_000268130.1.101885 WP_000268130.1.101976 WP_000268130.1.101995 WP_000268130.1.102023 WP_000268130.1.102110 WP_000268130.1.10256 WP_000268130.1.10328 WP_000268130.1.10375 WP_000268130.1.10466 WP_000268130.1.10512 WP_000268130.1.10649 WP_000268130.1.10725 WP_000268130.1.10777 WP_000268130.1.1080 WP_000268130.1.10838 WP_000268130.1.10852 WP_000268130.1.10909 WP_000268130.1.11003 WP_000268130.1.1101 WP_000268130.1.11016 WP_000268130.1.11090 WP_000268130.1.11203 WP_000268130.1.11305 WP_000268130.1.11307 WP_000268130.1.11308 WP_000268130.1.1138 WP_000268130.1.1155 WP_000268130.1.11698 WP_000268130.1.11910 WP_000268130.1.11923 WP_000268130.1.11925 WP_000268130.1.11926 WP_000268130.1.1194 WP_000268130.1.11989 WP_000268130.1.12109 WP_000268130.1.1216 WP_000268130.1.12250 WP_000268130.1.12322 WP_000268130.1.12414 WP_000268130.1.12477 WP_000268130.1.12529 WP_000268130.1.12617 WP_000268130.1.12638 WP_000268130.1.1270 WP_000268130.1.12702 WP_000268130.1.12796 WP_000268130.1.12818 WP_000268130.1.1283 WP_000268130.1.12912 WP_000268130.1.12974 WP_000268130.1.13047 WP_000268130.1.13078 WP_000268130.1.13109 WP_000268130.1.13137 WP_000268130.1.1317 WP_000268130.1.13195 WP_000268130.1.13220 WP_000268130.1.13236 WP_000268130.1.13480 WP_000268130.1.13485 WP_000268130.1.13516 WP_000268130.1.13521 WP_000268130.1.13596 WP_000268130.1.13616 WP_000268130.1.13635 WP_000268130.1.13651 WP_000268130.1.13699 WP_000268130.1.13761 WP_000268130.1.13821 WP_000268130.1.13850 WP_000268130.1.13871 WP_000268130.1.13894 WP_000268130.1.1390 WP_000268130.1.13916 WP_000268130.1.1396 WP_000268130.1.14020 WP_000268130.1.1411 WP_000268130.1.14187 WP_000268130.1.14271 WP_000268130.1.14311 WP_000268130.1.14354 WP_000268130.1.14357 WP_000268130.1.14385 WP_000268130.1.14392 WP_000268130.1.14479 WP_000268130.1.14515 WP_000268130.1.14650 WP_000268130.1.14700 WP_000268130.1.14801 WP_000268130.1.14829 WP_000268130.1.14853 WP_000268130.1.14854 WP_000268130.1.14909 WP_000268130.1.14939 WP_000268130.1.15066 WP_000268130.1.15152 WP_000268130.1.15166 WP_000268130.1.15289 WP_000268130.1.15383 WP_000268130.1.15462 WP_000268130.1.15465 WP_000268130.1.15497 WP_000268130.1.15651 WP_000268130.1.15653 WP_000268130.1.15656 WP_000268130.1.15695 WP_000268130.1.15713 WP_000268130.1.15778 WP_000268130.1.15793 WP_000268130.1.15821 WP_000268130.1.15947 WP_000268130.1.16011 WP_000268130.1.16178 WP_000268130.1.16202 WP_000268130.1.16288 WP_000268130.1.16325 WP_000268130.1.16343 WP_000268130.1.16371 WP_000268130.1.1639 WP_000268130.1.16398 WP_000268130.1.16411 WP_000268130.1.16434 WP_000268130.1.16510 WP_000268130.1.1656 WP_000268130.1.16576 WP_000268130.1.16579 WP_000268130.1.1658 WP_000268130.1.16607 WP_000268130.1.16610 WP_000268130.1.16699 WP_000268130.1.16701 WP_000268130.1.16760 WP_000268130.1.16787 WP_000268130.1.16850 WP_000268130.1.16864 WP_000268130.1.16993 WP_000268130.1.17002 WP_000268130.1.17021 WP_000268130.1.17097 WP_000268130.1.17244 WP_000268130.1.17414 WP_000268130.1.17433 WP_000268130.1.17468 WP_000268130.1.17492 WP_000268130.1.1753 WP_000268130.1.17646 WP_000268130.1.17664 WP_000268130.1.17752 WP_000268130.1.17781 WP_000268130.1.17999 WP_000268130.1.18082 WP_000268130.1.18091 WP_000268130.1.18238 WP_000268130.1.18302 WP_000268130.1.18325 WP_000268130.1.18385 WP_000268130.1.18499 WP_000268130.1.18546 WP_000268130.1.18755 WP_000268130.1.1893 WP_000268130.1.1910 WP_000268130.1.19120 WP_000268130.1.19131 WP_000268130.1.1916 WP_000268130.1.19168 WP_000268130.1.19292 WP_000268130.1.19339 WP_000268130.1.19396 WP_000268130.1.19531 WP_000268130.1.19670 WP_000268130.1.19750 WP_000268130.1.19826 WP_000268130.1.19877 WP_000268130.1.1995 WP_000268130.1.20044 WP_000268130.1.20066 WP_000268130.1.20120 WP_000268130.1.20176 WP_000268130.1.20194 WP_000268130.1.20306 WP_000268130.1.2033 WP_000268130.1.20359 WP_000268130.1.2039 WP_000268130.1.20444 WP_000268130.1.20534 WP_000268130.1.20541 WP_000268130.1.20571 WP_000268130.1.20656 WP_000268130.1.20748 WP_000268130.1.20755 WP_000268130.1.20807 WP_000268130.1.20816 WP_000268130.1.20830 WP_000268130.1.20889 WP_000268130.1.20987 WP_000268130.1.21032 WP_000268130.1.21112 WP_000268130.1.21117 WP_000268130.1.21264 WP_000268130.1.21337 WP_000268130.1.21484 WP_000268130.1.21546 WP_000268130.1.21554 WP_000268130.1.21662 WP_000268130.1.21689 WP_000268130.1.21738 WP_000268130.1.21747 WP_000268130.1.21939 WP_000268130.1.22047 WP_000268130.1.22053 WP_000268130.1.22108 WP_000268130.1.22209 WP_000268130.1.22286 WP_000268130.1.22301 WP_000268130.1.22349 WP_000268130.1.22396 WP_000268130.1.22452 WP_000268130.1.22469 WP_000268130.1.22515 WP_000268130.1.22586 WP_000268130.1.22687 WP_000268130.1.23023 WP_000268130.1.23188 WP_000268130.1.23243 WP_000268130.1.23328 WP_000268130.1.23401 WP_000268130.1.23636 WP_000268130.1.23651 WP_000268130.1.23669 WP_000268130.1.23771 WP_000268130.1.23821 WP_000268130.1.2386 WP_000268130.1.23975 WP_000268130.1.23997 WP_000268130.1.24015 WP_000268130.1.24097 WP_000268130.1.24105 WP_000268130.1.24152 WP_000268130.1.24178 WP_000268130.1.24260 WP_000268130.1.24292 WP_000268130.1.24358 WP_000268130.1.24373 WP_000268130.1.24449 WP_000268130.1.2445 WP_000268130.1.24545 WP_000268130.1.24611 WP_000268130.1.24621 WP_000268130.1.24744 WP_000268130.1.2475 WP_000268130.1.24750 WP_000268130.1.24916 WP_000268130.1.24927 WP_000268130.1.25091 WP_000268130.1.25131 WP_000268130.1.25263 WP_000268130.1.25292 WP_000268130.1.25478 WP_000268130.1.25519 WP_000268130.1.25524 WP_000268130.1.25560 WP_000268130.1.25588 WP_000268130.1.2559 WP_000268130.1.2561 WP_000268130.1.25638 WP_000268130.1.25689 WP_000268130.1.25723 WP_000268130.1.2585 WP_000268130.1.25850 WP_000268130.1.25971 WP_000268130.1.26151 WP_000268130.1.26181 WP_000268130.1.26204 WP_000268130.1.2626 WP_000268130.1.26352 WP_000268130.1.2641 WP_000268130.1.26425 WP_000268130.1.26436 WP_000268130.1.26472 WP_000268130.1.26504 WP_000268130.1.26528 WP_000268130.1.26647 WP_000268130.1.26649 WP_000268130.1.26669 WP_000268130.1.26678 WP_000268130.1.26715 WP_000268130.1.26744 WP_000268130.1.26921 WP_000268130.1.27059 WP_000268130.1.27109 WP_000268130.1.27176 WP_000268130.1.27220 WP_000268130.1.27265 WP_000268130.1.27270 WP_000268130.1.273 WP_000268130.1.2730 WP_000268130.1.27346 WP_000268130.1.2736 WP_000268130.1.2738 WP_000268130.1.27506 WP_000268130.1.27509 WP_000268130.1.2762 WP_000268130.1.2769 WP_000268130.1.27704 WP_000268130.1.27731 WP_000268130.1.27801 WP_000268130.1.27840 WP_000268130.1.27845 WP_000268130.1.27852 WP_000268130.1.27934 WP_000268130.1.27983 WP_000268130.1.28048 WP_000268130.1.28101 WP_000268130.1.28141 WP_000268130.1.28204 WP_000268130.1.28236 WP_000268130.1.28320 WP_000268130.1.28385 WP_000268130.1.28405 WP_000268130.1.28456 WP_000268130.1.28507 WP_000268130.1.28513 WP_000268130.1.28581 WP_000268130.1.28601 WP_000268130.1.28677 WP_000268130.1.28774 WP_000268130.1.28778 WP_000268130.1.28881 WP_000268130.1.28883 WP_000268130.1.28898 WP_000268130.1.28929 WP_000268130.1.28937 WP_000268130.1.28988 WP_000268130.1.29034 WP_000268130.1.29074 WP_000268130.1.29117 WP_000268130.1.29123 WP_000268130.1.29216 WP_000268130.1.29229 WP_000268130.1.29347 WP_000268130.1.29362 WP_000268130.1.29434 WP_000268130.1.29455 WP_000268130.1.29461 WP_000268130.1.29552 WP_000268130.1.29779 WP_000268130.1.2979 WP_000268130.1.29806 WP_000268130.1.29817 WP_000268130.1.29824 WP_000268130.1.29897 WP_000268130.1.30026 WP_000268130.1.30068 WP_000268130.1.30083 WP_000268130.1.30161 WP_000268130.1.30309 WP_000268130.1.30407 WP_000268130.1.30466 WP_000268130.1.30490 WP_000268130.1.30498 WP_000268130.1.30597 WP_000268130.1.30611 WP_000268130.1.30667 WP_000268130.1.30673 WP_000268130.1.3075 WP_000268130.1.30776 WP_000268130.1.30856 WP_000268130.1.30932 WP_000268130.1.30969 WP_000268130.1.30978 WP_000268130.1.30996 WP_000268130.1.31121 WP_000268130.1.31141 WP_000268130.1.3116 WP_000268130.1.31312 WP_000268130.1.31328 WP_000268130.1.31430 WP_000268130.1.3144 WP_000268130.1.3162 WP_000268130.1.3163 WP_000268130.1.31729 WP_000268130.1.31810 WP_000268130.1.31834 WP_000268130.1.31917 WP_000268130.1.3198 WP_000268130.1.31980 WP_000268130.1.32028 WP_000268130.1.32065 WP_000268130.1.32129 WP_000268130.1.3225 WP_000268130.1.32257 WP_000268130.1.32272 WP_000268130.1.32304 WP_000268130.1.32374 WP_000268130.1.32386 WP_000268130.1.32430 WP_000268130.1.32532 WP_000268130.1.32579 WP_000268130.1.32682 WP_000268130.1.32773 WP_000268130.1.3280 WP_000268130.1.32830 WP_000268130.1.32845 WP_000268130.1.32847 WP_000268130.1.32956 WP_000268130.1.32983 WP_000268130.1.3303 WP_000268130.1.33104 WP_000268130.1.33154 WP_000268130.1.33198 WP_000268130.1.33262 WP_000268130.1.33308 WP_000268130.1.33370 WP_000268130.1.33447 WP_000268130.1.3346 WP_000268130.1.33495 WP_000268130.1.33541 WP_000268130.1.33558 WP_000268130.1.33679 WP_000268130.1.33706 WP_000268130.1.33714 WP_000268130.1.33773 WP_000268130.1.33777 WP_000268130.1.33805 WP_000268130.1.33869 WP_000268130.1.33871 WP_000268130.1.33902 WP_000268130.1.33929 WP_000268130.1.33931 WP_000268130.1.33978 WP_000268130.1.33999 WP_000268130.1.34027 WP_000268130.1.34045 WP_000268130.1.34049 WP_000268130.1.34207 WP_000268130.1.34394 WP_000268130.1.34618 WP_000268130.1.34642 WP_000268130.1.34859 WP_000268130.1.35000 WP_000268130.1.35018 WP_000268130.1.35046 WP_000268130.1.35081 WP_000268130.1.35242 WP_000268130.1.35250 WP_000268130.1.35327 WP_000268130.1.3535 WP_000268130.1.35434 WP_000268130.1.35461 WP_000268130.1.35558 WP_000268130.1.35588 WP_000268130.1.35601 WP_000268130.1.35715 WP_000268130.1.35717 WP_000268130.1.35728 WP_000268130.1.35758 WP_000268130.1.35761 WP_000268130.1.35828 WP_000268130.1.35883 WP_000268130.1.35912 WP_000268130.1.3592 WP_000268130.1.36122 WP_000268130.1.36327 WP_000268130.1.36355 WP_000268130.1.36358 WP_000268130.1.36359 WP_000268130.1.36418 WP_000268130.1.36517 WP_000268130.1.36549 WP_000268130.1.36569 WP_000268130.1.36694 WP_000268130.1.36714 WP_000268130.1.36735 WP_000268130.1.36866 WP_000268130.1.36869 WP_000268130.1.36882 WP_000268130.1.36909 WP_000268130.1.36938 WP_000268130.1.3712 WP_000268130.1.37215 WP_000268130.1.37386 WP_000268130.1.37437 WP_000268130.1.3755 WP_000268130.1.3758 WP_000268130.1.37603 WP_000268130.1.37607 WP_000268130.1.37680 WP_000268130.1.37729 WP_000268130.1.37893 WP_000268130.1.37963 WP_000268130.1.37982 WP_000268130.1.38009 WP_000268130.1.38122 WP_000268130.1.38249 WP_000268130.1.38320 WP_000268130.1.3837 WP_000268130.1.3843 WP_000268130.1.3856 WP_000268130.1.3861 WP_000268130.1.38628 WP_000268130.1.38689 WP_000268130.1.38696 WP_000268130.1.38732 WP_000268130.1.38748 WP_000268130.1.38779 WP_000268130.1.38901 WP_000268130.1.38964 WP_000268130.1.39019 WP_000268130.1.39036 WP_000268130.1.39159 WP_000268130.1.39353 WP_000268130.1.39399 WP_000268130.1.39598 WP_000268130.1.39680 WP_000268130.1.39688 WP_000268130.1.397 WP_000268130.1.3974 WP_000268130.1.39799 WP_000268130.1.39901 WP_000268130.1.39911 WP_000268130.1.39928 WP_000268130.1.40199 WP_000268130.1.40200 WP_000268130.1.40225 WP_000268130.1.40233 WP_000268130.1.40297 WP_000268130.1.40332 WP_000268130.1.4047 WP_000268130.1.40490 WP_000268130.1.40497 WP_000268130.1.40547 WP_000268130.1.40645 WP_000268130.1.40679 WP_000268130.1.40762 WP_000268130.1.40832 WP_000268130.1.40836 WP_000268130.1.4086 WP_000268130.1.40864 WP_000268130.1.40947 WP_000268130.1.41029 WP_000268130.1.41059 WP_000268130.1.4110 WP_000268130.1.41201 WP_000268130.1.41266 WP_000268130.1.41395 WP_000268130.1.41425 WP_000268130.1.41507 WP_000268130.1.41546 WP_000268130.1.4164 WP_000268130.1.41707 WP_000268130.1.41720 WP_000268130.1.41738 WP_000268130.1.41777 WP_000268130.1.41878 WP_000268130.1.41922 WP_000268130.1.41934 WP_000268130.1.41936 WP_000268130.1.42080 WP_000268130.1.42172 WP_000268130.1.42253 WP_000268130.1.42289 WP_000268130.1.42351 WP_000268130.1.42401 WP_000268130.1.42484 WP_000268130.1.42531 WP_000268130.1.42561 WP_000268130.1.42571 WP_000268130.1.42581 WP_000268130.1.42708 WP_000268130.1.42721 WP_000268130.1.42765 WP_000268130.1.4277 WP_000268130.1.42773 WP_000268130.1.4281 WP_000268130.1.42824 WP_000268130.1.42888 WP_000268130.1.42928 WP_000268130.1.43011 WP_000268130.1.43028 WP_000268130.1.43094 WP_000268130.1.431 WP_000268130.1.43175 WP_000268130.1.43194 WP_000268130.1.43203 WP_000268130.1.43227 WP_000268130.1.43340 WP_000268130.1.43439 WP_000268130.1.43641 WP_000268130.1.43645 WP_000268130.1.43751 WP_000268130.1.43759 WP_000268130.1.43766 WP_000268130.1.4396 WP_000268130.1.43978 WP_000268130.1.44009 WP_000268130.1.44058 WP_000268130.1.44244 WP_000268130.1.44275 WP_000268130.1.44342 WP_000268130.1.44370 WP_000268130.1.44372 WP_000268130.1.44385 WP_000268130.1.44407 WP_000268130.1.44419 WP_000268130.1.44613 WP_000268130.1.44664 WP_000268130.1.44684 WP_000268130.1.44770 WP_000268130.1.44809 WP_000268130.1.44816 WP_000268130.1.4484 WP_000268130.1.44886 WP_000268130.1.44926 WP_000268130.1.44929 WP_000268130.1.44944 WP_000268130.1.44964 WP_000268130.1.44974 WP_000268130.1.44991 WP_000268130.1.45149 WP_000268130.1.45233 WP_000268130.1.45239 WP_000268130.1.45291 WP_000268130.1.45307 WP_000268130.1.45350 WP_000268130.1.4537 WP_000268130.1.45399 WP_000268130.1.45418 WP_000268130.1.45457 WP_000268130.1.45587 WP_000268130.1.45608 WP_000268130.1.45637 WP_000268130.1.45647 WP_000268130.1.45675 WP_000268130.1.45761 WP_000268130.1.45839 WP_000268130.1.45916 WP_000268130.1.46038 WP_000268130.1.46080 WP_000268130.1.46108 WP_000268130.1.46138 WP_000268130.1.46194 WP_000268130.1.46224 WP_000268130.1.46246 WP_000268130.1.46255 WP_000268130.1.46258 WP_000268130.1.46338 WP_000268130.1.46385 WP_000268130.1.46413 WP_000268130.1.46474 WP_000268130.1.4648 WP_000268130.1.46493 WP_000268130.1.46518 WP_000268130.1.46577 WP_000268130.1.46739 WP_000268130.1.46762 WP_000268130.1.46774 WP_000268130.1.46827 WP_000268130.1.4683 WP_000268130.1.46850 WP_000268130.1.46887 WP_000268130.1.46896 WP_000268130.1.46950 WP_000268130.1.46959 WP_000268130.1.47141 WP_000268130.1.47241 WP_000268130.1.47298 WP_000268130.1.47388 WP_000268130.1.47436 WP_000268130.1.47515 WP_000268130.1.47543 WP_000268130.1.47552 WP_000268130.1.47553 WP_000268130.1.47573 WP_000268130.1.47715 WP_000268130.1.47816 WP_000268130.1.47828 WP_000268130.1.47863 WP_000268130.1.47903 WP_000268130.1.47937 WP_000268130.1.48026 WP_000268130.1.48042 WP_000268130.1.48056 WP_000268130.1.48115 WP_000268130.1.4819 WP_000268130.1.4824 WP_000268130.1.48270 WP_000268130.1.48280 WP_000268130.1.48380 WP_000268130.1.48415 WP_000268130.1.48457 WP_000268130.1.48485 WP_000268130.1.48495 WP_000268130.1.48509 WP_000268130.1.48527 WP_000268130.1.4855 WP_000268130.1.48642 WP_000268130.1.48692 WP_000268130.1.48700 WP_000268130.1.48785 WP_000268130.1.48824 WP_000268130.1.4887 WP_000268130.1.489 WP_000268130.1.48925 WP_000268130.1.48977 WP_000268130.1.48988 WP_000268130.1.49083 WP_000268130.1.4911 WP_000268130.1.49228 WP_000268130.1.49261 WP_000268130.1.49318 WP_000268130.1.4935 WP_000268130.1.49380 WP_000268130.1.49405 WP_000268130.1.4941 WP_000268130.1.49410 WP_000268130.1.49463 WP_000268130.1.49564 WP_000268130.1.49639 WP_000268130.1.4967 WP_000268130.1.49673 WP_000268130.1.49705 WP_000268130.1.49789 WP_000268130.1.49849 WP_000268130.1.49866 WP_000268130.1.49896 WP_000268130.1.49928 WP_000268130.1.49960 WP_000268130.1.49992 WP_000268130.1.49993 WP_000268130.1.50011 WP_000268130.1.50097 WP_000268130.1.50111 WP_000268130.1.50150 WP_000268130.1.50208 WP_000268130.1.50216 WP_000268130.1.50220 WP_000268130.1.50223 WP_000268130.1.50267 WP_000268130.1.50298 WP_000268130.1.503 WP_000268130.1.50617 WP_000268130.1.50641 WP_000268130.1.50705 WP_000268130.1.50789 WP_000268130.1.50807 WP_000268130.1.50815 WP_000268130.1.50851 WP_000268130.1.50859 WP_000268130.1.50867 WP_000268130.1.50872 WP_000268130.1.50998 WP_000268130.1.51063 WP_000268130.1.51254 WP_000268130.1.51303 WP_000268130.1.51314 WP_000268130.1.51328 WP_000268130.1.51369 WP_000268130.1.51378 WP_000268130.1.51437 WP_000268130.1.51569 WP_000268130.1.51578 WP_000268130.1.51592 WP_000268130.1.51597 WP_000268130.1.51620 WP_000268130.1.51663 WP_000268130.1.51709 WP_000268130.1.5171 WP_000268130.1.51856 WP_000268130.1.51861 WP_000268130.1.51876 WP_000268130.1.5193 WP_000268130.1.51966 WP_000268130.1.52030 WP_000268130.1.52032 WP_000268130.1.5206 WP_000268130.1.52103 WP_000268130.1.52138 WP_000268130.1.52189 WP_000268130.1.5220 WP_000268130.1.52325 WP_000268130.1.52342 WP_000268130.1.52392 WP_000268130.1.52445 WP_000268130.1.52619 WP_000268130.1.5274 WP_000268130.1.52766 WP_000268130.1.52769 WP_000268130.1.52779 WP_000268130.1.5281 WP_000268130.1.52837 WP_000268130.1.52839 WP_000268130.1.52840 WP_000268130.1.52885 WP_000268130.1.52980 WP_000268130.1.52982 WP_000268130.1.53023 WP_000268130.1.53052 WP_000268130.1.53076 WP_000268130.1.53097 WP_000268130.1.53146 WP_000268130.1.53199 WP_000268130.1.53331 WP_000268130.1.53390 WP_000268130.1.53424 WP_000268130.1.53498 WP_000268130.1.53533 WP_000268130.1.53539 WP_000268130.1.53593 WP_000268130.1.53616 WP_000268130.1.53703 WP_000268130.1.53708 WP_000268130.1.53762 WP_000268130.1.53854 WP_000268130.1.53954 WP_000268130.1.53965 WP_000268130.1.54 WP_000268130.1.54055 WP_000268130.1.54088 WP_000268130.1.54108 WP_000268130.1.5412 WP_000268130.1.54138 WP_000268130.1.54139 WP_000268130.1.54171 WP_000268130.1.54242 WP_000268130.1.54266 WP_000268130.1.54300 WP_000268130.1.54352 WP_000268130.1.54361 WP_000268130.1.54451 WP_000268130.1.54464 WP_000268130.1.54492 WP_000268130.1.54566 WP_000268130.1.54581 WP_000268130.1.54664 WP_000268130.1.54712 WP_000268130.1.54741 WP_000268130.1.54761 WP_000268130.1.54885 WP_000268130.1.5489 WP_000268130.1.54963 WP_000268130.1.54977 WP_000268130.1.55045 WP_000268130.1.55062 WP_000268130.1.55096 WP_000268130.1.55155 WP_000268130.1.55201 WP_000268130.1.55363 WP_000268130.1.55368 WP_000268130.1.55376 WP_000268130.1.55447 WP_000268130.1.55491 WP_000268130.1.55516 WP_000268130.1.55631 WP_000268130.1.55638 WP_000268130.1.55773 WP_000268130.1.55799 WP_000268130.1.55952 WP_000268130.1.55997 WP_000268130.1.56027 WP_000268130.1.56067 WP_000268130.1.56076 WP_000268130.1.56102 WP_000268130.1.56165 WP_000268130.1.56211 WP_000268130.1.56246 WP_000268130.1.56379 WP_000268130.1.56538 WP_000268130.1.56668 WP_000268130.1.56712 WP_000268130.1.56717 WP_000268130.1.56798 WP_000268130.1.56833 WP_000268130.1.56841 WP_000268130.1.5697 WP_000268130.1.56991 WP_000268130.1.57078 WP_000268130.1.57346 WP_000268130.1.57408 WP_000268130.1.57457 WP_000268130.1.57465 WP_000268130.1.57535 WP_000268130.1.57543 WP_000268130.1.57606 WP_000268130.1.57654 WP_000268130.1.5769 WP_000268130.1.57731 WP_000268130.1.5780 WP_000268130.1.57829 WP_000268130.1.57874 WP_000268130.1.57987 WP_000268130.1.58061 WP_000268130.1.58115 WP_000268130.1.5822 WP_000268130.1.58269 WP_000268130.1.58319 WP_000268130.1.58337 WP_000268130.1.58453 WP_000268130.1.58503 WP_000268130.1.58506 WP_000268130.1.58570 WP_000268130.1.58621 WP_000268130.1.58802 WP_000268130.1.58969 WP_000268130.1.590 WP_000268130.1.59078 WP_000268130.1.5908 WP_000268130.1.59107 WP_000268130.1.59118 WP_000268130.1.59232 WP_000268130.1.59325 WP_000268130.1.59416 WP_000268130.1.59450 WP_000268130.1.59456 WP_000268130.1.59476 WP_000268130.1.59488 WP_000268130.1.59522 WP_000268130.1.5961 WP_000268130.1.59649 WP_000268130.1.59754 WP_000268130.1.59765 WP_000268130.1.5988 WP_000268130.1.59897 WP_000268130.1.59944 WP_000268130.1.59957 WP_000268130.1.600 WP_000268130.1.60059 WP_000268130.1.60099 WP_000268130.1.60108 WP_000268130.1.60116 WP_000268130.1.60176 WP_000268130.1.60198 WP_000268130.1.60243 WP_000268130.1.60299 WP_000268130.1.60316 WP_000268130.1.60318 WP_000268130.1.60359 WP_000268130.1.60474 WP_000268130.1.60484 WP_000268130.1.60546 WP_000268130.1.60581 WP_000268130.1.60589 WP_000268130.1.60609 WP_000268130.1.60616 WP_000268130.1.60655 WP_000268130.1.60669 WP_000268130.1.60678 WP_000268130.1.60697 WP_000268130.1.60933 WP_000268130.1.61105 WP_000268130.1.61291 WP_000268130.1.61336 WP_000268130.1.61410 WP_000268130.1.61441 WP_000268130.1.61452 WP_000268130.1.61477 WP_000268130.1.61527 WP_000268130.1.61578 WP_000268130.1.61637 WP_000268130.1.61704 WP_000268130.1.61759 WP_000268130.1.61974 WP_000268130.1.62011 WP_000268130.1.62067 WP_000268130.1.62150 WP_000268130.1.62191 WP_000268130.1.6221 WP_000268130.1.62308 WP_000268130.1.62368 WP_000268130.1.624 WP_000268130.1.62428 WP_000268130.1.62543 WP_000268130.1.6257 WP_000268130.1.62712 WP_000268130.1.62767 WP_000268130.1.6277 WP_000268130.1.62817 WP_000268130.1.62868 WP_000268130.1.6289 WP_000268130.1.62924 WP_000268130.1.62935 WP_000268130.1.63028 WP_000268130.1.63219 WP_000268130.1.63224 WP_000268130.1.63252 WP_000268130.1.63274 WP_000268130.1.63303 WP_000268130.1.63340 WP_000268130.1.63344 WP_000268130.1.63391 WP_000268130.1.63405 WP_000268130.1.63426 WP_000268130.1.63429 WP_000268130.1.6352 WP_000268130.1.63609 WP_000268130.1.63636 WP_000268130.1.63639 WP_000268130.1.63649 WP_000268130.1.63681 WP_000268130.1.63906 WP_000268130.1.63933 WP_000268130.1.64044 WP_000268130.1.64129 WP_000268130.1.64214 WP_000268130.1.64218 WP_000268130.1.64231 WP_000268130.1.64310 WP_000268130.1.64428 WP_000268130.1.64465 WP_000268130.1.6458 WP_000268130.1.64586 WP_000268130.1.64604 WP_000268130.1.64610 WP_000268130.1.64639 WP_000268130.1.64646 WP_000268130.1.64761 WP_000268130.1.64907 WP_000268130.1.64955 WP_000268130.1.64964 WP_000268130.1.65003 WP_000268130.1.65005 WP_000268130.1.65058 WP_000268130.1.6513 WP_000268130.1.65154 WP_000268130.1.65267 WP_000268130.1.65325 WP_000268130.1.65342 WP_000268130.1.65373 WP_000268130.1.65496 WP_000268130.1.65506 WP_000268130.1.65560 WP_000268130.1.65592 WP_000268130.1.65630 WP_000268130.1.65680 WP_000268130.1.65804 WP_000268130.1.65866 WP_000268130.1.65872 WP_000268130.1.65890 WP_000268130.1.65939 WP_000268130.1.65955 WP_000268130.1.65995 WP_000268130.1.66140 WP_000268130.1.66142 WP_000268130.1.66189 WP_000268130.1.66200 WP_000268130.1.66210 WP_000268130.1.66215 WP_000268130.1.66431 WP_000268130.1.66458 WP_000268130.1.66491 WP_000268130.1.66496 WP_000268130.1.66541 WP_000268130.1.66591 WP_000268130.1.66636 WP_000268130.1.66689 WP_000268130.1.66716 WP_000268130.1.66717 WP_000268130.1.66771 WP_000268130.1.66782 WP_000268130.1.66806 WP_000268130.1.66899 WP_000268130.1.67003 WP_000268130.1.67009 WP_000268130.1.67361 WP_000268130.1.67426 WP_000268130.1.67486 WP_000268130.1.67500 WP_000268130.1.67597 WP_000268130.1.67601 WP_000268130.1.67656 WP_000268130.1.6767 WP_000268130.1.67728 WP_000268130.1.67823 WP_000268130.1.67862 WP_000268130.1.67869 WP_000268130.1.67895 WP_000268130.1.67922 WP_000268130.1.67939 WP_000268130.1.68065 WP_000268130.1.68087 WP_000268130.1.68119 WP_000268130.1.68132 WP_000268130.1.68168 WP_000268130.1.6820 WP_000268130.1.68225 WP_000268130.1.68258 WP_000268130.1.68315 WP_000268130.1.68428 WP_000268130.1.68454 WP_000268130.1.6851 WP_000268130.1.6861 WP_000268130.1.68698 WP_000268130.1.68705 WP_000268130.1.68726 WP_000268130.1.68830 WP_000268130.1.68837 WP_000268130.1.68858 WP_000268130.1.68885 WP_000268130.1.68930 WP_000268130.1.69117 WP_000268130.1.69121 WP_000268130.1.69172 WP_000268130.1.69242 WP_000268130.1.69257 WP_000268130.1.69364 WP_000268130.1.69379 WP_000268130.1.69419 WP_000268130.1.69424 WP_000268130.1.69478 WP_000268130.1.6952 WP_000268130.1.69568 WP_000268130.1.69665 WP_000268130.1.69815 WP_000268130.1.69859 WP_000268130.1.69929 WP_000268130.1.69930 WP_000268130.1.70025 WP_000268130.1.70197 WP_000268130.1.70283 WP_000268130.1.70354 WP_000268130.1.70461 WP_000268130.1.70542 WP_000268130.1.70827 WP_000268130.1.70891 WP_000268130.1.70993 WP_000268130.1.71151 WP_000268130.1.71168 WP_000268130.1.71204 WP_000268130.1.71220 WP_000268130.1.71335 WP_000268130.1.71347 WP_000268130.1.71413 WP_000268130.1.71435 WP_000268130.1.71539 WP_000268130.1.71616 WP_000268130.1.71719 WP_000268130.1.7172 WP_000268130.1.71796 WP_000268130.1.71823 WP_000268130.1.71825 WP_000268130.1.71857 WP_000268130.1.71876 WP_000268130.1.71898 WP_000268130.1.71960 WP_000268130.1.71969 WP_000268130.1.71971 WP_000268130.1.72010 WP_000268130.1.72081 WP_000268130.1.72084 WP_000268130.1.7213 WP_000268130.1.72158 WP_000268130.1.72265 WP_000268130.1.72295 WP_000268130.1.72317 WP_000268130.1.72334 WP_000268130.1.72356 WP_000268130.1.72430 WP_000268130.1.7244 WP_000268130.1.72476 WP_000268130.1.72512 WP_000268130.1.72538 WP_000268130.1.72997 WP_000268130.1.73031 WP_000268130.1.73076 WP_000268130.1.73146 WP_000268130.1.73341 WP_000268130.1.73348 WP_000268130.1.73375 WP_000268130.1.73434 WP_000268130.1.73446 WP_000268130.1.73645 WP_000268130.1.73683 WP_000268130.1.73699 WP_000268130.1.73727 WP_000268130.1.73806 WP_000268130.1.73867 WP_000268130.1.73875 WP_000268130.1.73932 WP_000268130.1.74122 WP_000268130.1.74312 WP_000268130.1.74361 WP_000268130.1.74393 WP_000268130.1.74424 WP_000268130.1.74463 WP_000268130.1.7453 WP_000268130.1.74700 WP_000268130.1.74709 WP_000268130.1.74711 WP_000268130.1.74819 WP_000268130.1.74838 WP_000268130.1.74869 WP_000268130.1.74908 WP_000268130.1.74930 WP_000268130.1.74944 WP_000268130.1.74949 WP_000268130.1.75104 WP_000268130.1.75105 WP_000268130.1.75107 WP_000268130.1.75121 WP_000268130.1.75162 WP_000268130.1.7521 WP_000268130.1.75212 WP_000268130.1.75225 WP_000268130.1.75321 WP_000268130.1.75386 WP_000268130.1.75412 WP_000268130.1.75459 WP_000268130.1.75478 WP_000268130.1.75489 WP_000268130.1.75562 WP_000268130.1.75620 WP_000268130.1.75738 WP_000268130.1.75859 WP_000268130.1.75895 WP_000268130.1.75896 WP_000268130.1.75939 WP_000268130.1.76026 WP_000268130.1.7606 WP_000268130.1.76101 WP_000268130.1.76117 WP_000268130.1.76250 WP_000268130.1.76260 WP_000268130.1.76372 WP_000268130.1.76464 WP_000268130.1.76493 WP_000268130.1.7651 WP_000268130.1.76523 WP_000268130.1.76571 WP_000268130.1.76587 WP_000268130.1.76590 WP_000268130.1.7662 WP_000268130.1.76682 WP_000268130.1.76698 WP_000268130.1.76787 WP_000268130.1.76809 WP_000268130.1.76981 WP_000268130.1.77233 WP_000268130.1.77237 WP_000268130.1.77257 WP_000268130.1.77347 WP_000268130.1.77396 WP_000268130.1.77531 WP_000268130.1.77539 WP_000268130.1.7757 WP_000268130.1.77634 WP_000268130.1.77711 WP_000268130.1.77758 WP_000268130.1.77787 WP_000268130.1.77815 WP_000268130.1.77891 WP_000268130.1.77903 WP_000268130.1.7791 WP_000268130.1.77969 WP_000268130.1.77996 WP_000268130.1.78042 WP_000268130.1.78154 WP_000268130.1.7816 WP_000268130.1.78197 WP_000268130.1.78240 WP_000268130.1.7825 WP_000268130.1.78261 WP_000268130.1.78263 WP_000268130.1.78355 WP_000268130.1.78361 WP_000268130.1.78505 WP_000268130.1.7866 WP_000268130.1.78660 WP_000268130.1.78769 WP_000268130.1.78783 WP_000268130.1.78805 WP_000268130.1.78808 WP_000268130.1.78968 WP_000268130.1.78984 WP_000268130.1.79010 WP_000268130.1.79020 WP_000268130.1.79028 WP_000268130.1.79072 WP_000268130.1.7908 WP_000268130.1.79116 WP_000268130.1.79181 WP_000268130.1.79229 WP_000268130.1.79254 WP_000268130.1.79260 WP_000268130.1.79284 WP_000268130.1.793 WP_000268130.1.79328 WP_000268130.1.7938 WP_000268130.1.79405 WP_000268130.1.7949 WP_000268130.1.79567 WP_000268130.1.79701 WP_000268130.1.79720 WP_000268130.1.79728 WP_000268130.1.79736 WP_000268130.1.79774 WP_000268130.1.7978 WP_000268130.1.79789 WP_000268130.1.79797 WP_000268130.1.79889 WP_000268130.1.79909 WP_000268130.1.79938 WP_000268130.1.80092 WP_000268130.1.80121 WP_000268130.1.80125 WP_000268130.1.80143 WP_000268130.1.80162 WP_000268130.1.80195 WP_000268130.1.8021 WP_000268130.1.80655 WP_000268130.1.80665 WP_000268130.1.80686 WP_000268130.1.80730 WP_000268130.1.80766 WP_000268130.1.80887 WP_000268130.1.80897 WP_000268130.1.80987 WP_000268130.1.80989 WP_000268130.1.80997 WP_000268130.1.81002 WP_000268130.1.81068 WP_000268130.1.8108 WP_000268130.1.81161 WP_000268130.1.81240 WP_000268130.1.81253 WP_000268130.1.81294 WP_000268130.1.81319 WP_000268130.1.81345 WP_000268130.1.81373 WP_000268130.1.81412 WP_000268130.1.81441 WP_000268130.1.81466 WP_000268130.1.81468 WP_000268130.1.81597 WP_000268130.1.81700 WP_000268130.1.81704 WP_000268130.1.81764 WP_000268130.1.82036 WP_000268130.1.82039 WP_000268130.1.82040 WP_000268130.1.82082 WP_000268130.1.82090 WP_000268130.1.82110 WP_000268130.1.82203 WP_000268130.1.82235 WP_000268130.1.82286 WP_000268130.1.8230 WP_000268130.1.82355 WP_000268130.1.82366 WP_000268130.1.82453 WP_000268130.1.82504 WP_000268130.1.82538 WP_000268130.1.82561 WP_000268130.1.8264 WP_000268130.1.82786 WP_000268130.1.828 WP_000268130.1.82809 WP_000268130.1.82848 WP_000268130.1.82861 WP_000268130.1.82967 WP_000268130.1.83001 WP_000268130.1.8301 WP_000268130.1.83024 WP_000268130.1.83098 WP_000268130.1.8312 WP_000268130.1.83178 WP_000268130.1.83222 WP_000268130.1.83297 WP_000268130.1.83400 WP_000268130.1.83410 WP_000268130.1.83450 WP_000268130.1.83452 WP_000268130.1.83504 WP_000268130.1.83594 WP_000268130.1.836 WP_000268130.1.83693 WP_000268130.1.8377 WP_000268130.1.838 WP_000268130.1.83889 WP_000268130.1.83896 WP_000268130.1.83970 WP_000268130.1.84012 WP_000268130.1.84058 WP_000268130.1.84099 WP_000268130.1.84139 WP_000268130.1.84171 WP_000268130.1.84189 WP_000268130.1.84247 WP_000268130.1.84250 WP_000268130.1.84308 WP_000268130.1.84318 WP_000268130.1.84332 WP_000268130.1.84387 WP_000268130.1.84447 WP_000268130.1.84490 WP_000268130.1.84527 WP_000268130.1.84536 WP_000268130.1.84550 WP_000268130.1.84571 WP_000268130.1.84618 WP_000268130.1.84688 WP_000268130.1.84691 WP_000268130.1.84706 WP_000268130.1.8472 WP_000268130.1.84769 WP_000268130.1.84864 WP_000268130.1.84898 WP_000268130.1.84921 WP_000268130.1.84944 WP_000268130.1.85149 WP_000268130.1.85158 WP_000268130.1.85168 WP_000268130.1.85299 WP_000268130.1.85359 WP_000268130.1.85364 WP_000268130.1.85449 WP_000268130.1.85468 WP_000268130.1.85472 WP_000268130.1.85493 WP_000268130.1.85544 WP_000268130.1.8555 WP_000268130.1.85616 WP_000268130.1.85683 WP_000268130.1.85711 WP_000268130.1.85716 WP_000268130.1.85743 WP_000268130.1.85831 WP_000268130.1.85833 WP_000268130.1.85846 WP_000268130.1.85865 WP_000268130.1.85889 WP_000268130.1.85922 WP_000268130.1.8596 WP_000268130.1.8601 WP_000268130.1.86100 WP_000268130.1.86131 WP_000268130.1.86163 WP_000268130.1.86242 WP_000268130.1.86277 WP_000268130.1.86324 WP_000268130.1.86385 WP_000268130.1.86536 WP_000268130.1.86715 WP_000268130.1.86869 WP_000268130.1.86890 WP_000268130.1.86908 WP_000268130.1.86922 WP_000268130.1.86966 WP_000268130.1.86973 WP_000268130.1.86976 WP_000268130.1.87048 WP_000268130.1.87099 WP_000268130.1.87111 WP_000268130.1.87292 WP_000268130.1.87312 WP_000268130.1.87319 WP_000268130.1.87545 WP_000268130.1.87567 WP_000268130.1.87598 WP_000268130.1.87688 WP_000268130.1.87746 WP_000268130.1.87805 WP_000268130.1.87830 WP_000268130.1.88040 WP_000268130.1.88115 WP_000268130.1.88131 WP_000268130.1.88133 WP_000268130.1.88163 WP_000268130.1.88183 WP_000268130.1.88512 WP_000268130.1.88596 WP_000268130.1.8860 WP_000268130.1.88613 WP_000268130.1.88654 WP_000268130.1.88842 WP_000268130.1.88956 WP_000268130.1.89172 WP_000268130.1.89199 WP_000268130.1.89209 WP_000268130.1.89218 WP_000268130.1.89289 WP_000268130.1.89376 WP_000268130.1.89383 WP_000268130.1.89410 WP_000268130.1.89419 WP_000268130.1.89459 WP_000268130.1.89484 WP_000268130.1.89568 WP_000268130.1.89611 WP_000268130.1.89643 WP_000268130.1.89653 WP_000268130.1.89685 WP_000268130.1.89790 WP_000268130.1.89792 WP_000268130.1.89836 WP_000268130.1.89876 WP_000268130.1.89878 WP_000268130.1.89906 WP_000268130.1.9008 WP_000268130.1.90087 WP_000268130.1.90118 WP_000268130.1.90132 WP_000268130.1.90262 WP_000268130.1.90310 WP_000268130.1.90362 WP_000268130.1.90375 WP_000268130.1.90378 WP_000268130.1.9038 WP_000268130.1.90413 WP_000268130.1.90656 WP_000268130.1.90697 WP_000268130.1.90743 WP_000268130.1.90755 WP_000268130.1.90781 WP_000268130.1.90932 WP_000268130.1.90953 WP_000268130.1.91085 WP_000268130.1.91147 WP_000268130.1.91206 WP_000268130.1.91249 WP_000268130.1.91286 WP_000268130.1.91335 WP_000268130.1.9134 WP_000268130.1.91355 WP_000268130.1.91477 WP_000268130.1.91502 WP_000268130.1.91523 WP_000268130.1.91612 WP_000268130.1.91696 WP_000268130.1.9172 WP_000268130.1.91752 WP_000268130.1.91762 WP_000268130.1.91780 WP_000268130.1.91789 WP_000268130.1.91832 WP_000268130.1.91854 WP_000268130.1.91908 WP_000268130.1.91941 WP_000268130.1.91998 WP_000268130.1.92112 WP_000268130.1.92128 WP_000268130.1.92179 WP_000268130.1.9233 WP_000268130.1.92365 WP_000268130.1.92417 WP_000268130.1.92515 WP_000268130.1.92611 WP_000268130.1.92623 WP_000268130.1.92687 WP_000268130.1.92711 WP_000268130.1.92749 WP_000268130.1.92815 WP_000268130.1.92830 WP_000268130.1.92945 WP_000268130.1.92998 WP_000268130.1.9309 WP_000268130.1.93094 WP_000268130.1.93114 WP_000268130.1.93151 WP_000268130.1.9316 WP_000268130.1.93280 WP_000268130.1.93437 WP_000268130.1.93451 WP_000268130.1.93485 WP_000268130.1.93580 WP_000268130.1.93594 WP_000268130.1.93682 WP_000268130.1.93778 WP_000268130.1.93796 WP_000268130.1.93849 WP_000268130.1.93868 WP_000268130.1.93948 WP_000268130.1.93991 WP_000268130.1.94012 WP_000268130.1.94015 WP_000268130.1.94034 WP_000268130.1.94129 WP_000268130.1.94265 WP_000268130.1.94387 WP_000268130.1.94410 WP_000268130.1.94668 WP_000268130.1.94672 WP_000268130.1.94725 WP_000268130.1.94740 WP_000268130.1.94816 WP_000268130.1.94826 WP_000268130.1.94900 WP_000268130.1.94948 WP_000268130.1.95001 WP_000268130.1.95026 WP_000268130.1.95040 WP_000268130.1.95092 WP_000268130.1.95109 WP_000268130.1.95220 WP_000268130.1.95260 WP_000268130.1.95269 WP_000268130.1.95270 WP_000268130.1.9536 WP_000268130.1.95539 WP_000268130.1.95622 WP_000268130.1.95653 WP_000268130.1.95665 WP_000268130.1.95755 WP_000268130.1.95844 WP_000268130.1.95859 WP_000268130.1.95873 WP_000268130.1.95923 WP_000268130.1.9593 WP_000268130.1.96029 WP_000268130.1.96046 WP_000268130.1.962 WP_000268130.1.96323 WP_000268130.1.9645 WP_000268130.1.96556 WP_000268130.1.96598 WP_000268130.1.96696 WP_000268130.1.96741 WP_000268130.1.96747 WP_000268130.1.96930 WP_000268130.1.96942 WP_000268130.1.96998 WP_000268130.1.97032 WP_000268130.1.9714 WP_000268130.1.97163 WP_000268130.1.97180 WP_000268130.1.97300 WP_000268130.1.9733 WP_000268130.1.97520 WP_000268130.1.97709 WP_000268130.1.97710 WP_000268130.1.97780 WP_000268130.1.97844 WP_000268130.1.97893 WP_000268130.1.97920 WP_000268130.1.98004 WP_000268130.1.98007 WP_000268130.1.98068 WP_000268130.1.98150 WP_000268130.1.98224 WP_000268130.1.98272 WP_000268130.1.9832 WP_000268130.1.98354 WP_000268130.1.98434 WP_000268130.1.98523 WP_000268130.1.98561 WP_000268130.1.98595 WP_000268130.1.98625 WP_000268130.1.98691 WP_000268130.1.98692 WP_000268130.1.987 WP_000268130.1.98806 WP_000268130.1.98835 WP_000268130.1.98919 WP_000268130.1.98950 WP_000268130.1.98965 WP_000268130.1.98968 WP_000268130.1.98998 WP_000268130.1.99048 WP_000268130.1.99049 WP_000268130.1.99077 WP_000268130.1.99120 WP_000268130.1.99162 WP_000268130.1.99188 WP_000268130.1.99206 WP_000268130.1.99250 WP_000268130.1.99391 WP_000268130.1.99420 WP_000268130.1.99449 WP_000268130.1.99464 WP_000268130.1.9952 WP_000268130.1.99555 WP_000268130.1.99653 WP_000268130.1.99697 WP_000268130.1.99770 WP_000268130.1.99775 WP_000268130.1.99806 WP_000268130.1.99825 WP_000268130.1.99833 WP_000268130.1.99868 WP_000268130.1.99964 WP_000268130.1.9997 gi|523522092|ref|YP_008208171.1| gi|213156498|ref|YP_002318159.1| gi|384141937|ref|YP_005524647.1| gi|169634251|ref|YP_001707987.1| gi|523526008|ref|YP_008212039.1| gi|384130654|ref|YP_005513266.1| gi|385236246|ref|YP_005797585.1| gi|184156977|ref|YP_001845316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]