SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387123090|ref|YP_006288972.1| from Acinetobacter baumannii MDR-TJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387123090|ref|YP_006288972.1|
Domain Number 1 Region: 19-496
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.77e-116
Family Pyridoxal-dependent decarboxylase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387123090|ref|YP_006288972.1|
Sequence length 510
Comment PLP-dependent enzyme, glutamate decarboxylase [Acinetobacter baumannii MDR-TJ]
Sequence
MVDFAEHRKALLCNDAQSIADYESAMGEAVKAVSAWLQNEKMYTGGSIKELRSAISFQPS
KEGMGVQQSLQRMIELFLNKSLKVHHPHSLAHLHCPTMVMSQIAEVLINATNQSMDSWDQ
SPAGSLMEVQLIDWLRQKVGYGSGQAGVFTSGGTQSNLMGVLLARDWCIAKNWKDENGNP
WSVQRDGIPAEAMKNVKVICSENAHFSVQKNMAMMGMGFQSVVTVPVNENAQMDVDALEK
TMAHLQSEGKVVACVVATAGTTDAGAIDPLKKIREITNKYGSWMHIDAAWGGALILSNDY
RAMLDGIELSDSITLDFHKHYFQSISCGAFLLKDEANYRFMHYEAEYLNSAYDEEHGVPN
LVSKSLQTTRRFDALKLWMTIESLGEELYGSMIDHGVKLTREVADYIKATDGLELLVEPQ
FASVLFRVVPEGYPVEFIDSLNQNVADELFARGEANIGVTKVGNVQSLKMTTLSPVVTVD
NVKNLLAQVLAEAERIKDAIASGNYVPPID
Download sequence
Identical sequences A0A0E1PPL6 A0A0R1C6U3 A0A219CDR2 G2JK63 N9I1S5
gi|407933639|ref|YP_006849282.1| gi|387123090|ref|YP_006288972.1| gi|384144153|ref|YP_005526863.1| gi|523527991|ref|YP_008214022.1| WP_000227392.1.100119 WP_000227392.1.100136 WP_000227392.1.100157 WP_000227392.1.100211 WP_000227392.1.100222 WP_000227392.1.100238 WP_000227392.1.100290 WP_000227392.1.1003 WP_000227392.1.100380 WP_000227392.1.100406 WP_000227392.1.100568 WP_000227392.1.10058 WP_000227392.1.100616 WP_000227392.1.100656 WP_000227392.1.100957 WP_000227392.1.100971 WP_000227392.1.101001 WP_000227392.1.101005 WP_000227392.1.101012 WP_000227392.1.101037 WP_000227392.1.101100 WP_000227392.1.101243 WP_000227392.1.101254 WP_000227392.1.101276 WP_000227392.1.10136 WP_000227392.1.1014 WP_000227392.1.101413 WP_000227392.1.10147 WP_000227392.1.101515 WP_000227392.1.101574 WP_000227392.1.101742 WP_000227392.1.101810 WP_000227392.1.101850 WP_000227392.1.101885 WP_000227392.1.101910 WP_000227392.1.101976 WP_000227392.1.101995 WP_000227392.1.102023 WP_000227392.1.102110 WP_000227392.1.10256 WP_000227392.1.10328 WP_000227392.1.10375 WP_000227392.1.10466 WP_000227392.1.10512 WP_000227392.1.10725 WP_000227392.1.10768 WP_000227392.1.10777 WP_000227392.1.1080 WP_000227392.1.10838 WP_000227392.1.10852 WP_000227392.1.10909 WP_000227392.1.11003 WP_000227392.1.1101 WP_000227392.1.11016 WP_000227392.1.11019 WP_000227392.1.11090 WP_000227392.1.11203 WP_000227392.1.11307 WP_000227392.1.11308 WP_000227392.1.11374 WP_000227392.1.1138 WP_000227392.1.1155 WP_000227392.1.11698 WP_000227392.1.11923 WP_000227392.1.11925 WP_000227392.1.11926 WP_000227392.1.11989 WP_000227392.1.1216 WP_000227392.1.12250 WP_000227392.1.12322 WP_000227392.1.12414 WP_000227392.1.12477 WP_000227392.1.12529 WP_000227392.1.12617 WP_000227392.1.12638 WP_000227392.1.1270 WP_000227392.1.12702 WP_000227392.1.12796 WP_000227392.1.12818 WP_000227392.1.1283 WP_000227392.1.12912 WP_000227392.1.12974 WP_000227392.1.13047 WP_000227392.1.13078 WP_000227392.1.13137 WP_000227392.1.1317 WP_000227392.1.13195 WP_000227392.1.13220 WP_000227392.1.13236 WP_000227392.1.13485 WP_000227392.1.13516 WP_000227392.1.13521 WP_000227392.1.13616 WP_000227392.1.13651 WP_000227392.1.13699 WP_000227392.1.13761 WP_000227392.1.13821 WP_000227392.1.13871 WP_000227392.1.13894 WP_000227392.1.1390 WP_000227392.1.13916 WP_000227392.1.1396 WP_000227392.1.14020 WP_000227392.1.1411 WP_000227392.1.14187 WP_000227392.1.14271 WP_000227392.1.14311 WP_000227392.1.14354 WP_000227392.1.14357 WP_000227392.1.14385 WP_000227392.1.14392 WP_000227392.1.14479 WP_000227392.1.14515 WP_000227392.1.14650 WP_000227392.1.14700 WP_000227392.1.14801 WP_000227392.1.14829 WP_000227392.1.14853 WP_000227392.1.14854 WP_000227392.1.14909 WP_000227392.1.14939 WP_000227392.1.15152 WP_000227392.1.15166 WP_000227392.1.15289 WP_000227392.1.15383 WP_000227392.1.15462 WP_000227392.1.15465 WP_000227392.1.15497 WP_000227392.1.15651 WP_000227392.1.15653 WP_000227392.1.15656 WP_000227392.1.15695 WP_000227392.1.15778 WP_000227392.1.15793 WP_000227392.1.15821 WP_000227392.1.15947 WP_000227392.1.16011 WP_000227392.1.16178 WP_000227392.1.16202 WP_000227392.1.16325 WP_000227392.1.16371 WP_000227392.1.1639 WP_000227392.1.16411 WP_000227392.1.16434 WP_000227392.1.16510 WP_000227392.1.1656 WP_000227392.1.16576 WP_000227392.1.16579 WP_000227392.1.1658 WP_000227392.1.16607 WP_000227392.1.16610 WP_000227392.1.16699 WP_000227392.1.16717 WP_000227392.1.16864 WP_000227392.1.16993 WP_000227392.1.17021 WP_000227392.1.17244 WP_000227392.1.17433 WP_000227392.1.17468 WP_000227392.1.17492 WP_000227392.1.17632 WP_000227392.1.17646 WP_000227392.1.17664 WP_000227392.1.17752 WP_000227392.1.17781 WP_000227392.1.17999 WP_000227392.1.18082 WP_000227392.1.18091 WP_000227392.1.18238 WP_000227392.1.18302 WP_000227392.1.18325 WP_000227392.1.18385 WP_000227392.1.18546 WP_000227392.1.18755 WP_000227392.1.1893 WP_000227392.1.1910 WP_000227392.1.19120 WP_000227392.1.19131 WP_000227392.1.1916 WP_000227392.1.19168 WP_000227392.1.19292 WP_000227392.1.19339 WP_000227392.1.19396 WP_000227392.1.19475 WP_000227392.1.19531 WP_000227392.1.19670 WP_000227392.1.19826 WP_000227392.1.19877 WP_000227392.1.1995 WP_000227392.1.20044 WP_000227392.1.20120 WP_000227392.1.20176 WP_000227392.1.20306 WP_000227392.1.2033 WP_000227392.1.20359 WP_000227392.1.2039 WP_000227392.1.20444 WP_000227392.1.20534 WP_000227392.1.20541 WP_000227392.1.20571 WP_000227392.1.20656 WP_000227392.1.20748 WP_000227392.1.20807 WP_000227392.1.20816 WP_000227392.1.20817 WP_000227392.1.20830 WP_000227392.1.20998 WP_000227392.1.21032 WP_000227392.1.21112 WP_000227392.1.21117 WP_000227392.1.21190 WP_000227392.1.21264 WP_000227392.1.21337 WP_000227392.1.21484 WP_000227392.1.21546 WP_000227392.1.21662 WP_000227392.1.21689 WP_000227392.1.21738 WP_000227392.1.21747 WP_000227392.1.21939 WP_000227392.1.22047 WP_000227392.1.22053 WP_000227392.1.22108 WP_000227392.1.22209 WP_000227392.1.22286 WP_000227392.1.22301 WP_000227392.1.22349 WP_000227392.1.22396 WP_000227392.1.22452 WP_000227392.1.22469 WP_000227392.1.22515 WP_000227392.1.22586 WP_000227392.1.22687 WP_000227392.1.23023 WP_000227392.1.23141 WP_000227392.1.23173 WP_000227392.1.23188 WP_000227392.1.23234 WP_000227392.1.23243 WP_000227392.1.23328 WP_000227392.1.23401 WP_000227392.1.23636 WP_000227392.1.23651 WP_000227392.1.23669 WP_000227392.1.2386 WP_000227392.1.23975 WP_000227392.1.23997 WP_000227392.1.24015 WP_000227392.1.24041 WP_000227392.1.24097 WP_000227392.1.24105 WP_000227392.1.24152 WP_000227392.1.24178 WP_000227392.1.24260 WP_000227392.1.24358 WP_000227392.1.24373 WP_000227392.1.24449 WP_000227392.1.2445 WP_000227392.1.24545 WP_000227392.1.24611 WP_000227392.1.24621 WP_000227392.1.24706 WP_000227392.1.24744 WP_000227392.1.24750 WP_000227392.1.24927 WP_000227392.1.25091 WP_000227392.1.25143 WP_000227392.1.25263 WP_000227392.1.25292 WP_000227392.1.25478 WP_000227392.1.25519 WP_000227392.1.25524 WP_000227392.1.25560 WP_000227392.1.2559 WP_000227392.1.2561 WP_000227392.1.25689 WP_000227392.1.25723 WP_000227392.1.2585 WP_000227392.1.25850 WP_000227392.1.25971 WP_000227392.1.26181 WP_000227392.1.26204 WP_000227392.1.2626 WP_000227392.1.26352 WP_000227392.1.26425 WP_000227392.1.26436 WP_000227392.1.26504 WP_000227392.1.26528 WP_000227392.1.26647 WP_000227392.1.26649 WP_000227392.1.26669 WP_000227392.1.26678 WP_000227392.1.26715 WP_000227392.1.26744 WP_000227392.1.27059 WP_000227392.1.27109 WP_000227392.1.27176 WP_000227392.1.27265 WP_000227392.1.27270 WP_000227392.1.273 WP_000227392.1.2730 WP_000227392.1.27346 WP_000227392.1.2736 WP_000227392.1.2738 WP_000227392.1.27506 WP_000227392.1.27509 WP_000227392.1.2762 WP_000227392.1.2769 WP_000227392.1.27704 WP_000227392.1.27731 WP_000227392.1.27801 WP_000227392.1.27845 WP_000227392.1.27852 WP_000227392.1.27934 WP_000227392.1.27983 WP_000227392.1.28048 WP_000227392.1.28101 WP_000227392.1.28141 WP_000227392.1.28204 WP_000227392.1.28246 WP_000227392.1.28320 WP_000227392.1.28385 WP_000227392.1.28405 WP_000227392.1.28411 WP_000227392.1.28456 WP_000227392.1.28507 WP_000227392.1.28513 WP_000227392.1.28601 WP_000227392.1.28677 WP_000227392.1.28774 WP_000227392.1.28881 WP_000227392.1.28883 WP_000227392.1.28898 WP_000227392.1.28929 WP_000227392.1.28937 WP_000227392.1.28988 WP_000227392.1.29074 WP_000227392.1.29117 WP_000227392.1.29123 WP_000227392.1.29216 WP_000227392.1.29229 WP_000227392.1.29347 WP_000227392.1.29362 WP_000227392.1.29434 WP_000227392.1.29455 WP_000227392.1.29552 WP_000227392.1.2979 WP_000227392.1.29806 WP_000227392.1.29817 WP_000227392.1.29824 WP_000227392.1.29897 WP_000227392.1.30026 WP_000227392.1.30083 WP_000227392.1.30161 WP_000227392.1.30309 WP_000227392.1.30407 WP_000227392.1.30490 WP_000227392.1.30611 WP_000227392.1.30667 WP_000227392.1.30673 WP_000227392.1.3075 WP_000227392.1.30776 WP_000227392.1.30856 WP_000227392.1.30932 WP_000227392.1.30969 WP_000227392.1.30978 WP_000227392.1.30996 WP_000227392.1.31141 WP_000227392.1.3116 WP_000227392.1.31328 WP_000227392.1.31430 WP_000227392.1.3144 WP_000227392.1.3162 WP_000227392.1.3163 WP_000227392.1.31729 WP_000227392.1.31810 WP_000227392.1.31834 WP_000227392.1.3198 WP_000227392.1.31980 WP_000227392.1.32028 WP_000227392.1.32065 WP_000227392.1.32129 WP_000227392.1.32257 WP_000227392.1.32272 WP_000227392.1.32304 WP_000227392.1.32374 WP_000227392.1.32386 WP_000227392.1.32579 WP_000227392.1.32682 WP_000227392.1.32773 WP_000227392.1.3280 WP_000227392.1.32830 WP_000227392.1.32845 WP_000227392.1.32847 WP_000227392.1.32956 WP_000227392.1.3303 WP_000227392.1.33104 WP_000227392.1.33154 WP_000227392.1.33262 WP_000227392.1.33370 WP_000227392.1.33386 WP_000227392.1.33447 WP_000227392.1.3346 WP_000227392.1.33495 WP_000227392.1.33541 WP_000227392.1.33558 WP_000227392.1.33679 WP_000227392.1.33706 WP_000227392.1.33714 WP_000227392.1.33777 WP_000227392.1.33805 WP_000227392.1.33869 WP_000227392.1.33902 WP_000227392.1.33929 WP_000227392.1.33931 WP_000227392.1.33978 WP_000227392.1.33999 WP_000227392.1.34027 WP_000227392.1.34045 WP_000227392.1.34049 WP_000227392.1.34207 WP_000227392.1.34394 WP_000227392.1.34577 WP_000227392.1.34618 WP_000227392.1.34642 WP_000227392.1.34859 WP_000227392.1.35000 WP_000227392.1.35018 WP_000227392.1.35046 WP_000227392.1.35242 WP_000227392.1.35250 WP_000227392.1.35327 WP_000227392.1.3535 WP_000227392.1.35461 WP_000227392.1.35558 WP_000227392.1.35588 WP_000227392.1.35601 WP_000227392.1.35715 WP_000227392.1.35717 WP_000227392.1.35728 WP_000227392.1.35758 WP_000227392.1.35761 WP_000227392.1.35828 WP_000227392.1.35883 WP_000227392.1.35912 WP_000227392.1.36327 WP_000227392.1.36355 WP_000227392.1.36358 WP_000227392.1.36359 WP_000227392.1.36418 WP_000227392.1.36517 WP_000227392.1.36549 WP_000227392.1.36569 WP_000227392.1.36694 WP_000227392.1.36714 WP_000227392.1.36735 WP_000227392.1.36866 WP_000227392.1.36869 WP_000227392.1.36882 WP_000227392.1.36909 WP_000227392.1.36938 WP_000227392.1.3712 WP_000227392.1.37215 WP_000227392.1.37437 WP_000227392.1.3758 WP_000227392.1.37603 WP_000227392.1.37607 WP_000227392.1.37680 WP_000227392.1.37729 WP_000227392.1.37807 WP_000227392.1.37893 WP_000227392.1.37963 WP_000227392.1.37982 WP_000227392.1.38009 WP_000227392.1.38122 WP_000227392.1.38249 WP_000227392.1.38320 WP_000227392.1.3837 WP_000227392.1.3843 WP_000227392.1.3861 WP_000227392.1.38628 WP_000227392.1.38696 WP_000227392.1.38732 WP_000227392.1.38748 WP_000227392.1.38779 WP_000227392.1.38901 WP_000227392.1.38964 WP_000227392.1.39019 WP_000227392.1.39353 WP_000227392.1.39399 WP_000227392.1.39598 WP_000227392.1.39680 WP_000227392.1.39688 WP_000227392.1.397 WP_000227392.1.3974 WP_000227392.1.39911 WP_000227392.1.39928 WP_000227392.1.40199 WP_000227392.1.40200 WP_000227392.1.40225 WP_000227392.1.40233 WP_000227392.1.40297 WP_000227392.1.40332 WP_000227392.1.4047 WP_000227392.1.40490 WP_000227392.1.40547 WP_000227392.1.40645 WP_000227392.1.40832 WP_000227392.1.40836 WP_000227392.1.4086 WP_000227392.1.40864 WP_000227392.1.40947 WP_000227392.1.41029 WP_000227392.1.41059 WP_000227392.1.4110 WP_000227392.1.41201 WP_000227392.1.41266 WP_000227392.1.41395 WP_000227392.1.41425 WP_000227392.1.41507 WP_000227392.1.41546 WP_000227392.1.4164 WP_000227392.1.41707 WP_000227392.1.41720 WP_000227392.1.41738 WP_000227392.1.41777 WP_000227392.1.41838 WP_000227392.1.41922 WP_000227392.1.41934 WP_000227392.1.41936 WP_000227392.1.42080 WP_000227392.1.42172 WP_000227392.1.42253 WP_000227392.1.42289 WP_000227392.1.42351 WP_000227392.1.42377 WP_000227392.1.42401 WP_000227392.1.42484 WP_000227392.1.42531 WP_000227392.1.42561 WP_000227392.1.42571 WP_000227392.1.42708 WP_000227392.1.42765 WP_000227392.1.4277 WP_000227392.1.42773 WP_000227392.1.4281 WP_000227392.1.42824 WP_000227392.1.42888 WP_000227392.1.42928 WP_000227392.1.43011 WP_000227392.1.43028 WP_000227392.1.43094 WP_000227392.1.431 WP_000227392.1.4311 WP_000227392.1.43175 WP_000227392.1.43194 WP_000227392.1.43203 WP_000227392.1.43227 WP_000227392.1.43340 WP_000227392.1.43439 WP_000227392.1.43641 WP_000227392.1.43645 WP_000227392.1.43751 WP_000227392.1.43755 WP_000227392.1.43759 WP_000227392.1.4396 WP_000227392.1.43978 WP_000227392.1.44009 WP_000227392.1.44275 WP_000227392.1.44342 WP_000227392.1.44370 WP_000227392.1.44372 WP_000227392.1.44407 WP_000227392.1.44613 WP_000227392.1.44664 WP_000227392.1.44684 WP_000227392.1.44770 WP_000227392.1.44809 WP_000227392.1.44816 WP_000227392.1.44886 WP_000227392.1.44926 WP_000227392.1.44929 WP_000227392.1.44944 WP_000227392.1.44974 WP_000227392.1.44991 WP_000227392.1.45149 WP_000227392.1.45233 WP_000227392.1.45291 WP_000227392.1.45350 WP_000227392.1.4537 WP_000227392.1.45399 WP_000227392.1.45418 WP_000227392.1.45457 WP_000227392.1.45587 WP_000227392.1.45608 WP_000227392.1.45637 WP_000227392.1.45647 WP_000227392.1.45675 WP_000227392.1.45761 WP_000227392.1.45839 WP_000227392.1.45916 WP_000227392.1.46108 WP_000227392.1.46138 WP_000227392.1.46194 WP_000227392.1.46246 WP_000227392.1.46255 WP_000227392.1.46258 WP_000227392.1.46338 WP_000227392.1.46385 WP_000227392.1.46392 WP_000227392.1.46413 WP_000227392.1.46474 WP_000227392.1.4648 WP_000227392.1.46493 WP_000227392.1.46518 WP_000227392.1.46577 WP_000227392.1.46739 WP_000227392.1.46762 WP_000227392.1.46774 WP_000227392.1.46827 WP_000227392.1.4683 WP_000227392.1.46850 WP_000227392.1.46918 WP_000227392.1.46950 WP_000227392.1.46959 WP_000227392.1.47241 WP_000227392.1.47298 WP_000227392.1.47388 WP_000227392.1.47515 WP_000227392.1.47543 WP_000227392.1.47552 WP_000227392.1.47573 WP_000227392.1.47715 WP_000227392.1.47816 WP_000227392.1.47828 WP_000227392.1.47863 WP_000227392.1.47903 WP_000227392.1.48042 WP_000227392.1.48115 WP_000227392.1.4819 WP_000227392.1.4824 WP_000227392.1.48270 WP_000227392.1.48280 WP_000227392.1.48380 WP_000227392.1.48415 WP_000227392.1.48457 WP_000227392.1.48495 WP_000227392.1.48509 WP_000227392.1.48529 WP_000227392.1.48642 WP_000227392.1.48692 WP_000227392.1.48700 WP_000227392.1.48785 WP_000227392.1.48824 WP_000227392.1.4887 WP_000227392.1.489 WP_000227392.1.48988 WP_000227392.1.49083 WP_000227392.1.4911 WP_000227392.1.49228 WP_000227392.1.49261 WP_000227392.1.49318 WP_000227392.1.4935 WP_000227392.1.49380 WP_000227392.1.49405 WP_000227392.1.4941 WP_000227392.1.49564 WP_000227392.1.49639 WP_000227392.1.4967 WP_000227392.1.49705 WP_000227392.1.49789 WP_000227392.1.49849 WP_000227392.1.49866 WP_000227392.1.49896 WP_000227392.1.49928 WP_000227392.1.49960 WP_000227392.1.49992 WP_000227392.1.50011 WP_000227392.1.50097 WP_000227392.1.50208 WP_000227392.1.50223 WP_000227392.1.50267 WP_000227392.1.50298 WP_000227392.1.503 WP_000227392.1.50617 WP_000227392.1.50641 WP_000227392.1.50789 WP_000227392.1.50815 WP_000227392.1.50851 WP_000227392.1.50859 WP_000227392.1.50867 WP_000227392.1.50872 WP_000227392.1.51063 WP_000227392.1.51303 WP_000227392.1.51328 WP_000227392.1.51369 WP_000227392.1.51437 WP_000227392.1.51569 WP_000227392.1.51578 WP_000227392.1.51597 WP_000227392.1.51640 WP_000227392.1.51663 WP_000227392.1.5171 WP_000227392.1.51856 WP_000227392.1.51861 WP_000227392.1.5193 WP_000227392.1.51966 WP_000227392.1.52032 WP_000227392.1.5206 WP_000227392.1.52103 WP_000227392.1.52138 WP_000227392.1.52189 WP_000227392.1.5220 WP_000227392.1.52325 WP_000227392.1.52392 WP_000227392.1.52445 WP_000227392.1.52619 WP_000227392.1.5274 WP_000227392.1.52769 WP_000227392.1.52779 WP_000227392.1.5281 WP_000227392.1.52837 WP_000227392.1.52839 WP_000227392.1.52840 WP_000227392.1.52885 WP_000227392.1.52980 WP_000227392.1.52982 WP_000227392.1.53023 WP_000227392.1.53052 WP_000227392.1.53097 WP_000227392.1.53144 WP_000227392.1.53146 WP_000227392.1.53331 WP_000227392.1.53390 WP_000227392.1.53424 WP_000227392.1.53498 WP_000227392.1.53533 WP_000227392.1.53593 WP_000227392.1.53616 WP_000227392.1.53708 WP_000227392.1.53762 WP_000227392.1.53854 WP_000227392.1.53954 WP_000227392.1.54 WP_000227392.1.54055 WP_000227392.1.54088 WP_000227392.1.5412 WP_000227392.1.54139 WP_000227392.1.54242 WP_000227392.1.54266 WP_000227392.1.54300 WP_000227392.1.54352 WP_000227392.1.54361 WP_000227392.1.54451 WP_000227392.1.54566 WP_000227392.1.54581 WP_000227392.1.54664 WP_000227392.1.54718 WP_000227392.1.54741 WP_000227392.1.54761 WP_000227392.1.5489 WP_000227392.1.54963 WP_000227392.1.54977 WP_000227392.1.55062 WP_000227392.1.55096 WP_000227392.1.55155 WP_000227392.1.55201 WP_000227392.1.55321 WP_000227392.1.55363 WP_000227392.1.55368 WP_000227392.1.55376 WP_000227392.1.55516 WP_000227392.1.55638 WP_000227392.1.55773 WP_000227392.1.55799 WP_000227392.1.55952 WP_000227392.1.55997 WP_000227392.1.56027 WP_000227392.1.56067 WP_000227392.1.56076 WP_000227392.1.56102 WP_000227392.1.56165 WP_000227392.1.56211 WP_000227392.1.56246 WP_000227392.1.56379 WP_000227392.1.56538 WP_000227392.1.56668 WP_000227392.1.56712 WP_000227392.1.56717 WP_000227392.1.56833 WP_000227392.1.56841 WP_000227392.1.5697 WP_000227392.1.56991 WP_000227392.1.57078 WP_000227392.1.57346 WP_000227392.1.57408 WP_000227392.1.57457 WP_000227392.1.57465 WP_000227392.1.57535 WP_000227392.1.57543 WP_000227392.1.57606 WP_000227392.1.57654 WP_000227392.1.5769 WP_000227392.1.5780 WP_000227392.1.57829 WP_000227392.1.57874 WP_000227392.1.58061 WP_000227392.1.58115 WP_000227392.1.5822 WP_000227392.1.58269 WP_000227392.1.58337 WP_000227392.1.58453 WP_000227392.1.58506 WP_000227392.1.58621 WP_000227392.1.58969 WP_000227392.1.590 WP_000227392.1.59078 WP_000227392.1.5908 WP_000227392.1.59107 WP_000227392.1.59325 WP_000227392.1.59416 WP_000227392.1.59476 WP_000227392.1.59488 WP_000227392.1.59522 WP_000227392.1.5961 WP_000227392.1.59649 WP_000227392.1.59754 WP_000227392.1.59765 WP_000227392.1.59897 WP_000227392.1.59957 WP_000227392.1.600 WP_000227392.1.60059 WP_000227392.1.60099 WP_000227392.1.60108 WP_000227392.1.60116 WP_000227392.1.60176 WP_000227392.1.60198 WP_000227392.1.60243 WP_000227392.1.60299 WP_000227392.1.60316 WP_000227392.1.60318 WP_000227392.1.60359 WP_000227392.1.60474 WP_000227392.1.60581 WP_000227392.1.60589 WP_000227392.1.60609 WP_000227392.1.60616 WP_000227392.1.60655 WP_000227392.1.60669 WP_000227392.1.60697 WP_000227392.1.61105 WP_000227392.1.61291 WP_000227392.1.61336 WP_000227392.1.61410 WP_000227392.1.61441 WP_000227392.1.61452 WP_000227392.1.61477 WP_000227392.1.61527 WP_000227392.1.61578 WP_000227392.1.61637 WP_000227392.1.61704 WP_000227392.1.61974 WP_000227392.1.62011 WP_000227392.1.62067 WP_000227392.1.62150 WP_000227392.1.62191 WP_000227392.1.62308 WP_000227392.1.62368 WP_000227392.1.624 WP_000227392.1.62428 WP_000227392.1.62543 WP_000227392.1.6257 WP_000227392.1.62712 WP_000227392.1.62767 WP_000227392.1.6277 WP_000227392.1.62868 WP_000227392.1.62924 WP_000227392.1.62935 WP_000227392.1.63028 WP_000227392.1.63219 WP_000227392.1.63252 WP_000227392.1.63274 WP_000227392.1.63303 WP_000227392.1.63340 WP_000227392.1.63391 WP_000227392.1.63405 WP_000227392.1.63426 WP_000227392.1.63429 WP_000227392.1.6352 WP_000227392.1.63609 WP_000227392.1.63636 WP_000227392.1.63639 WP_000227392.1.63681 WP_000227392.1.63857 WP_000227392.1.63933 WP_000227392.1.64129 WP_000227392.1.64214 WP_000227392.1.64218 WP_000227392.1.64310 WP_000227392.1.64428 WP_000227392.1.64465 WP_000227392.1.64604 WP_000227392.1.64639 WP_000227392.1.64834 WP_000227392.1.64907 WP_000227392.1.64955 WP_000227392.1.64964 WP_000227392.1.65003 WP_000227392.1.65005 WP_000227392.1.65058 WP_000227392.1.6513 WP_000227392.1.65267 WP_000227392.1.65325 WP_000227392.1.65342 WP_000227392.1.65373 WP_000227392.1.65496 WP_000227392.1.65527 WP_000227392.1.65560 WP_000227392.1.65592 WP_000227392.1.65630 WP_000227392.1.65680 WP_000227392.1.65804 WP_000227392.1.65866 WP_000227392.1.65890 WP_000227392.1.65939 WP_000227392.1.65955 WP_000227392.1.65995 WP_000227392.1.66140 WP_000227392.1.66142 WP_000227392.1.66189 WP_000227392.1.66200 WP_000227392.1.66210 WP_000227392.1.66215 WP_000227392.1.66431 WP_000227392.1.66458 WP_000227392.1.66491 WP_000227392.1.66496 WP_000227392.1.66541 WP_000227392.1.66591 WP_000227392.1.66636 WP_000227392.1.66689 WP_000227392.1.66716 WP_000227392.1.66717 WP_000227392.1.66782 WP_000227392.1.66806 WP_000227392.1.66899 WP_000227392.1.67009 WP_000227392.1.67361 WP_000227392.1.67426 WP_000227392.1.67486 WP_000227392.1.67500 WP_000227392.1.67597 WP_000227392.1.67601 WP_000227392.1.67656 WP_000227392.1.6767 WP_000227392.1.67728 WP_000227392.1.67862 WP_000227392.1.67869 WP_000227392.1.67895 WP_000227392.1.67922 WP_000227392.1.67939 WP_000227392.1.68065 WP_000227392.1.68087 WP_000227392.1.68119 WP_000227392.1.68132 WP_000227392.1.68168 WP_000227392.1.6820 WP_000227392.1.68225 WP_000227392.1.68315 WP_000227392.1.6841 WP_000227392.1.68428 WP_000227392.1.68454 WP_000227392.1.6851 WP_000227392.1.6861 WP_000227392.1.68698 WP_000227392.1.68830 WP_000227392.1.68837 WP_000227392.1.68858 WP_000227392.1.68885 WP_000227392.1.689 WP_000227392.1.68930 WP_000227392.1.69117 WP_000227392.1.69121 WP_000227392.1.69172 WP_000227392.1.69193 WP_000227392.1.69242 WP_000227392.1.69257 WP_000227392.1.69364 WP_000227392.1.69379 WP_000227392.1.69419 WP_000227392.1.69424 WP_000227392.1.69478 WP_000227392.1.6952 WP_000227392.1.69568 WP_000227392.1.69586 WP_000227392.1.69609 WP_000227392.1.69665 WP_000227392.1.69815 WP_000227392.1.69929 WP_000227392.1.69930 WP_000227392.1.70025 WP_000227392.1.70154 WP_000227392.1.70197 WP_000227392.1.70283 WP_000227392.1.70354 WP_000227392.1.70542 WP_000227392.1.70827 WP_000227392.1.70891 WP_000227392.1.71005 WP_000227392.1.71151 WP_000227392.1.71168 WP_000227392.1.71204 WP_000227392.1.71220 WP_000227392.1.71335 WP_000227392.1.71413 WP_000227392.1.71539 WP_000227392.1.71650 WP_000227392.1.71719 WP_000227392.1.71796 WP_000227392.1.71823 WP_000227392.1.71825 WP_000227392.1.71857 WP_000227392.1.71876 WP_000227392.1.71960 WP_000227392.1.71969 WP_000227392.1.71971 WP_000227392.1.72084 WP_000227392.1.7213 WP_000227392.1.72158 WP_000227392.1.72265 WP_000227392.1.72295 WP_000227392.1.72317 WP_000227392.1.72334 WP_000227392.1.72430 WP_000227392.1.7244 WP_000227392.1.72538 WP_000227392.1.72997 WP_000227392.1.73076 WP_000227392.1.73146 WP_000227392.1.73341 WP_000227392.1.73348 WP_000227392.1.73375 WP_000227392.1.73434 WP_000227392.1.73446 WP_000227392.1.73542 WP_000227392.1.73645 WP_000227392.1.73699 WP_000227392.1.73727 WP_000227392.1.73806 WP_000227392.1.73867 WP_000227392.1.73875 WP_000227392.1.73932 WP_000227392.1.74122 WP_000227392.1.74312 WP_000227392.1.74424 WP_000227392.1.74463 WP_000227392.1.7453 WP_000227392.1.74700 WP_000227392.1.74709 WP_000227392.1.74711 WP_000227392.1.74819 WP_000227392.1.74838 WP_000227392.1.74869 WP_000227392.1.74930 WP_000227392.1.75104 WP_000227392.1.75107 WP_000227392.1.75121 WP_000227392.1.7521 WP_000227392.1.75225 WP_000227392.1.75386 WP_000227392.1.75412 WP_000227392.1.75459 WP_000227392.1.75489 WP_000227392.1.75562 WP_000227392.1.75569 WP_000227392.1.75738 WP_000227392.1.75812 WP_000227392.1.75859 WP_000227392.1.75895 WP_000227392.1.75939 WP_000227392.1.76026 WP_000227392.1.7606 WP_000227392.1.76101 WP_000227392.1.76117 WP_000227392.1.76250 WP_000227392.1.76260 WP_000227392.1.76372 WP_000227392.1.76464 WP_000227392.1.76493 WP_000227392.1.76587 WP_000227392.1.7662 WP_000227392.1.76682 WP_000227392.1.76698 WP_000227392.1.76787 WP_000227392.1.76809 WP_000227392.1.76871 WP_000227392.1.76953 WP_000227392.1.76981 WP_000227392.1.77237 WP_000227392.1.77257 WP_000227392.1.77274 WP_000227392.1.77347 WP_000227392.1.77539 WP_000227392.1.7757 WP_000227392.1.77634 WP_000227392.1.77711 WP_000227392.1.77758 WP_000227392.1.77787 WP_000227392.1.77815 WP_000227392.1.77891 WP_000227392.1.77903 WP_000227392.1.7791 WP_000227392.1.77996 WP_000227392.1.78042 WP_000227392.1.78154 WP_000227392.1.7816 WP_000227392.1.78240 WP_000227392.1.7825 WP_000227392.1.78261 WP_000227392.1.78263 WP_000227392.1.78355 WP_000227392.1.78505 WP_000227392.1.7864 WP_000227392.1.7866 WP_000227392.1.78660 WP_000227392.1.78769 WP_000227392.1.78783 WP_000227392.1.78805 WP_000227392.1.78808 WP_000227392.1.79010 WP_000227392.1.79028 WP_000227392.1.79072 WP_000227392.1.7908 WP_000227392.1.79181 WP_000227392.1.79229 WP_000227392.1.79260 WP_000227392.1.79261 WP_000227392.1.79284 WP_000227392.1.793 WP_000227392.1.79328 WP_000227392.1.7938 WP_000227392.1.79405 WP_000227392.1.7949 WP_000227392.1.79567 WP_000227392.1.79701 WP_000227392.1.79720 WP_000227392.1.79736 WP_000227392.1.79774 WP_000227392.1.7978 WP_000227392.1.79889 WP_000227392.1.79909 WP_000227392.1.79938 WP_000227392.1.80092 WP_000227392.1.80121 WP_000227392.1.80125 WP_000227392.1.80143 WP_000227392.1.80162 WP_000227392.1.80195 WP_000227392.1.8021 WP_000227392.1.80665 WP_000227392.1.80730 WP_000227392.1.80766 WP_000227392.1.80887 WP_000227392.1.80897 WP_000227392.1.80987 WP_000227392.1.80997 WP_000227392.1.81002 WP_000227392.1.8103 WP_000227392.1.81068 WP_000227392.1.81161 WP_000227392.1.81240 WP_000227392.1.81253 WP_000227392.1.81319 WP_000227392.1.81345 WP_000227392.1.81373 WP_000227392.1.81412 WP_000227392.1.81441 WP_000227392.1.81466 WP_000227392.1.81700 WP_000227392.1.81704 WP_000227392.1.81764 WP_000227392.1.82039 WP_000227392.1.82040 WP_000227392.1.82082 WP_000227392.1.82090 WP_000227392.1.82110 WP_000227392.1.82203 WP_000227392.1.82235 WP_000227392.1.82286 WP_000227392.1.8230 WP_000227392.1.82366 WP_000227392.1.82453 WP_000227392.1.82504 WP_000227392.1.82538 WP_000227392.1.82561 WP_000227392.1.82786 WP_000227392.1.828 WP_000227392.1.82809 WP_000227392.1.82848 WP_000227392.1.82861 WP_000227392.1.83001 WP_000227392.1.8301 WP_000227392.1.83098 WP_000227392.1.8312 WP_000227392.1.83178 WP_000227392.1.83400 WP_000227392.1.83410 WP_000227392.1.83450 WP_000227392.1.83474 WP_000227392.1.83594 WP_000227392.1.836 WP_000227392.1.83693 WP_000227392.1.8377 WP_000227392.1.838 WP_000227392.1.83889 WP_000227392.1.83896 WP_000227392.1.84012 WP_000227392.1.84058 WP_000227392.1.84139 WP_000227392.1.84171 WP_000227392.1.84247 WP_000227392.1.84250 WP_000227392.1.84308 WP_000227392.1.84332 WP_000227392.1.84387 WP_000227392.1.84447 WP_000227392.1.84490 WP_000227392.1.84527 WP_000227392.1.84536 WP_000227392.1.84550 WP_000227392.1.84571 WP_000227392.1.84618 WP_000227392.1.84688 WP_000227392.1.84691 WP_000227392.1.84706 WP_000227392.1.8472 WP_000227392.1.84769 WP_000227392.1.84864 WP_000227392.1.84898 WP_000227392.1.84921 WP_000227392.1.84944 WP_000227392.1.85149 WP_000227392.1.85158 WP_000227392.1.85168 WP_000227392.1.85185 WP_000227392.1.85254 WP_000227392.1.85299 WP_000227392.1.85364 WP_000227392.1.85468 WP_000227392.1.85472 WP_000227392.1.85493 WP_000227392.1.85544 WP_000227392.1.85616 WP_000227392.1.85711 WP_000227392.1.85716 WP_000227392.1.85743 WP_000227392.1.85833 WP_000227392.1.85846 WP_000227392.1.85889 WP_000227392.1.85922 WP_000227392.1.8596 WP_000227392.1.8601 WP_000227392.1.86100 WP_000227392.1.86131 WP_000227392.1.86163 WP_000227392.1.86242 WP_000227392.1.86277 WP_000227392.1.86324 WP_000227392.1.86385 WP_000227392.1.86536 WP_000227392.1.86715 WP_000227392.1.86890 WP_000227392.1.86908 WP_000227392.1.86922 WP_000227392.1.86966 WP_000227392.1.86973 WP_000227392.1.86976 WP_000227392.1.87048 WP_000227392.1.87099 WP_000227392.1.87111 WP_000227392.1.87312 WP_000227392.1.87567 WP_000227392.1.87598 WP_000227392.1.87688 WP_000227392.1.87727 WP_000227392.1.87746 WP_000227392.1.87830 WP_000227392.1.88109 WP_000227392.1.88115 WP_000227392.1.88131 WP_000227392.1.88133 WP_000227392.1.88163 WP_000227392.1.88183 WP_000227392.1.88512 WP_000227392.1.88596 WP_000227392.1.8860 WP_000227392.1.88613 WP_000227392.1.88654 WP_000227392.1.88842 WP_000227392.1.88956 WP_000227392.1.89172 WP_000227392.1.89199 WP_000227392.1.89209 WP_000227392.1.89218 WP_000227392.1.89289 WP_000227392.1.89376 WP_000227392.1.89383 WP_000227392.1.89412 WP_000227392.1.89419 WP_000227392.1.89459 WP_000227392.1.89484 WP_000227392.1.89568 WP_000227392.1.89611 WP_000227392.1.89653 WP_000227392.1.89685 WP_000227392.1.89790 WP_000227392.1.89792 WP_000227392.1.89836 WP_000227392.1.89878 WP_000227392.1.89906 WP_000227392.1.90087 WP_000227392.1.90118 WP_000227392.1.90132 WP_000227392.1.90262 WP_000227392.1.90310 WP_000227392.1.90375 WP_000227392.1.90378 WP_000227392.1.9038 WP_000227392.1.90413 WP_000227392.1.90656 WP_000227392.1.90697 WP_000227392.1.90704 WP_000227392.1.90743 WP_000227392.1.90755 WP_000227392.1.90781 WP_000227392.1.90932 WP_000227392.1.90953 WP_000227392.1.91085 WP_000227392.1.91147 WP_000227392.1.91206 WP_000227392.1.91249 WP_000227392.1.91286 WP_000227392.1.91335 WP_000227392.1.9134 WP_000227392.1.91355 WP_000227392.1.91477 WP_000227392.1.91502 WP_000227392.1.91523 WP_000227392.1.91696 WP_000227392.1.9172 WP_000227392.1.91762 WP_000227392.1.91780 WP_000227392.1.91789 WP_000227392.1.91854 WP_000227392.1.91908 WP_000227392.1.91941 WP_000227392.1.91998 WP_000227392.1.92112 WP_000227392.1.92128 WP_000227392.1.92179 WP_000227392.1.9228 WP_000227392.1.9233 WP_000227392.1.92365 WP_000227392.1.92417 WP_000227392.1.92515 WP_000227392.1.92687 WP_000227392.1.92711 WP_000227392.1.92749 WP_000227392.1.92830 WP_000227392.1.92945 WP_000227392.1.92998 WP_000227392.1.9309 WP_000227392.1.93094 WP_000227392.1.93114 WP_000227392.1.93151 WP_000227392.1.9316 WP_000227392.1.93280 WP_000227392.1.93451 WP_000227392.1.93580 WP_000227392.1.93682 WP_000227392.1.93778 WP_000227392.1.93796 WP_000227392.1.93849 WP_000227392.1.93868 WP_000227392.1.93948 WP_000227392.1.93991 WP_000227392.1.94015 WP_000227392.1.94034 WP_000227392.1.94144 WP_000227392.1.94265 WP_000227392.1.94387 WP_000227392.1.94410 WP_000227392.1.94725 WP_000227392.1.94740 WP_000227392.1.94826 WP_000227392.1.94900 WP_000227392.1.94948 WP_000227392.1.95026 WP_000227392.1.95040 WP_000227392.1.95092 WP_000227392.1.95109 WP_000227392.1.95111 WP_000227392.1.95220 WP_000227392.1.95260 WP_000227392.1.95269 WP_000227392.1.95270 WP_000227392.1.9536 WP_000227392.1.95363 WP_000227392.1.95539 WP_000227392.1.95622 WP_000227392.1.95653 WP_000227392.1.95665 WP_000227392.1.95755 WP_000227392.1.95844 WP_000227392.1.95859 WP_000227392.1.95873 WP_000227392.1.95923 WP_000227392.1.9593 WP_000227392.1.96029 WP_000227392.1.96046 WP_000227392.1.962 WP_000227392.1.96323 WP_000227392.1.9645 WP_000227392.1.96556 WP_000227392.1.96598 WP_000227392.1.96696 WP_000227392.1.96747 WP_000227392.1.96930 WP_000227392.1.96942 WP_000227392.1.96998 WP_000227392.1.97032 WP_000227392.1.9714 WP_000227392.1.97163 WP_000227392.1.9733 WP_000227392.1.97520 WP_000227392.1.97709 WP_000227392.1.97710 WP_000227392.1.97780 WP_000227392.1.97844 WP_000227392.1.97893 WP_000227392.1.97920 WP_000227392.1.9794 WP_000227392.1.98004 WP_000227392.1.98007 WP_000227392.1.98068 WP_000227392.1.98150 WP_000227392.1.98224 WP_000227392.1.98272 WP_000227392.1.9832 WP_000227392.1.98354 WP_000227392.1.98434 WP_000227392.1.98523 WP_000227392.1.98561 WP_000227392.1.98625 WP_000227392.1.98691 WP_000227392.1.98692 WP_000227392.1.987 WP_000227392.1.98806 WP_000227392.1.98835 WP_000227392.1.98919 WP_000227392.1.98950 WP_000227392.1.98965 WP_000227392.1.98968 WP_000227392.1.98986 WP_000227392.1.98998 WP_000227392.1.99048 WP_000227392.1.99049 WP_000227392.1.99077 WP_000227392.1.99120 WP_000227392.1.99162 WP_000227392.1.99188 WP_000227392.1.99206 WP_000227392.1.99250 WP_000227392.1.99391 WP_000227392.1.99420 WP_000227392.1.99449 WP_000227392.1.99464 WP_000227392.1.9952 WP_000227392.1.99555 WP_000227392.1.99653 WP_000227392.1.99775 WP_000227392.1.99825 WP_000227392.1.99833 WP_000227392.1.99868 WP_000227392.1.99964 WP_000227392.1.9997 gi|523524201|ref|YP_008210280.1| gi|184158979|ref|YP_001847318.1| 405416.ACICU_02659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]