SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387123337|ref|YP_006289219.1| from Acinetobacter baumannii MDR-TJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387123337|ref|YP_006289219.1|
Domain Number 1 Region: 133-344,378-520
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.08e-45
Family AAT-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387123337|ref|YP_006289219.1|
Sequence length 532
Comment aspartate 4-decarboxylase [Acinetobacter baumannii MDR-TJ]
Sequence
MGKVDYSKYAKLSPFELKDNLIELAQSKTDRMMLNAGRGNPNFLATIPRRAFFQLGLFSA
TESEFSFSYMPEGLGGFPRPVGLQSRFDNFILENRDKPGIVFLGKAVSYVRDQLGLDPDL
FLLEMVEGILGCNYPVPDRMLRVSETIIKEYVLREMGVQGMQKSDLDLFAVEGGTAAMAY
IFNSLKENKIIKNGDRIAIGSPIFTPYLEIPKLNDYQLEEVLIEADPKLGWQYPESELRK
LEDPSIKAFFLVNPSNPPSVKMSDEGLAILADIVKKRPDLIILTDDVYGTFADNFKSLFA
ICPDNTILVYSFSKYFGATGWRLGVIALSNNNVLDKQIANLSKKEKKELEDRYSSLTTDP
ASIKFIDRLVADSRNVALNHTAGLSTPQQVQMVLFALFNMMDSRQSYKKAVKSVVRERDA
ALYRQLGVDVPTDPNAVDYYTLVNLENTSRTLYGDEFADWVMKNKNPTELLFRVADETGV
VLLPGSGFGVQHPSARASLANLNEYQYAAIGESLRRFADEAYAEYTKAKKIK
Download sequence
Identical sequences A0A062LMG5 A0A0R1BY08 A0A219C9X9
gi|523523951|ref|YP_008210030.1| gi|384131241|ref|YP_005513853.1| gi|407933353|ref|YP_006848996.1| gi|387123337|ref|YP_006289219.1| gi|523527742|ref|YP_008213773.1| 405416.ACICU_02407 gi|184158727|ref|YP_001847066.1| gi|385238145|ref|YP_005799484.1| WP_000520927.1.100157 WP_000520927.1.100238 WP_000520927.1.100290 WP_000520927.1.1003 WP_000520927.1.100406 WP_000520927.1.100568 WP_000520927.1.10058 WP_000520927.1.100616 WP_000520927.1.100656 WP_000520927.1.100957 WP_000520927.1.100971 WP_000520927.1.101001 WP_000520927.1.101005 WP_000520927.1.101012 WP_000520927.1.101037 WP_000520927.1.101100 WP_000520927.1.101243 WP_000520927.1.101254 WP_000520927.1.101258 WP_000520927.1.101276 WP_000520927.1.10136 WP_000520927.1.101413 WP_000520927.1.10147 WP_000520927.1.101515 WP_000520927.1.101574 WP_000520927.1.101742 WP_000520927.1.101810 WP_000520927.1.101850 WP_000520927.1.101885 WP_000520927.1.101910 WP_000520927.1.101976 WP_000520927.1.101995 WP_000520927.1.10256 WP_000520927.1.10328 WP_000520927.1.10375 WP_000520927.1.10466 WP_000520927.1.10512 WP_000520927.1.10649 WP_000520927.1.10725 WP_000520927.1.10768 WP_000520927.1.10777 WP_000520927.1.1080 WP_000520927.1.10838 WP_000520927.1.10852 WP_000520927.1.10909 WP_000520927.1.11003 WP_000520927.1.1101 WP_000520927.1.11016 WP_000520927.1.11090 WP_000520927.1.11203 WP_000520927.1.11307 WP_000520927.1.11308 WP_000520927.1.11374 WP_000520927.1.1138 WP_000520927.1.1155 WP_000520927.1.11698 WP_000520927.1.11910 WP_000520927.1.11923 WP_000520927.1.11925 WP_000520927.1.11989 WP_000520927.1.1216 WP_000520927.1.12250 WP_000520927.1.12322 WP_000520927.1.12414 WP_000520927.1.12529 WP_000520927.1.12617 WP_000520927.1.12638 WP_000520927.1.1270 WP_000520927.1.12702 WP_000520927.1.12818 WP_000520927.1.1283 WP_000520927.1.12912 WP_000520927.1.12974 WP_000520927.1.13047 WP_000520927.1.13078 WP_000520927.1.13137 WP_000520927.1.1317 WP_000520927.1.13195 WP_000520927.1.13220 WP_000520927.1.13236 WP_000520927.1.13485 WP_000520927.1.13516 WP_000520927.1.13521 WP_000520927.1.13616 WP_000520927.1.13651 WP_000520927.1.13699 WP_000520927.1.13761 WP_000520927.1.13821 WP_000520927.1.13871 WP_000520927.1.13894 WP_000520927.1.1390 WP_000520927.1.13916 WP_000520927.1.1396 WP_000520927.1.1411 WP_000520927.1.14187 WP_000520927.1.14271 WP_000520927.1.14357 WP_000520927.1.14392 WP_000520927.1.14479 WP_000520927.1.14515 WP_000520927.1.14650 WP_000520927.1.14700 WP_000520927.1.14801 WP_000520927.1.14829 WP_000520927.1.14853 WP_000520927.1.14854 WP_000520927.1.14939 WP_000520927.1.15166 WP_000520927.1.15289 WP_000520927.1.15383 WP_000520927.1.15462 WP_000520927.1.15465 WP_000520927.1.15651 WP_000520927.1.15653 WP_000520927.1.15656 WP_000520927.1.15695 WP_000520927.1.15793 WP_000520927.1.15821 WP_000520927.1.16011 WP_000520927.1.16178 WP_000520927.1.16202 WP_000520927.1.16325 WP_000520927.1.16371 WP_000520927.1.16411 WP_000520927.1.16434 WP_000520927.1.1656 WP_000520927.1.16576 WP_000520927.1.16579 WP_000520927.1.1658 WP_000520927.1.16610 WP_000520927.1.16699 WP_000520927.1.16717 WP_000520927.1.16993 WP_000520927.1.17021 WP_000520927.1.17433 WP_000520927.1.17468 WP_000520927.1.17492 WP_000520927.1.17632 WP_000520927.1.17646 WP_000520927.1.17664 WP_000520927.1.17752 WP_000520927.1.17781 WP_000520927.1.18082 WP_000520927.1.18091 WP_000520927.1.18238 WP_000520927.1.18302 WP_000520927.1.18325 WP_000520927.1.18385 WP_000520927.1.18546 WP_000520927.1.18755 WP_000520927.1.19120 WP_000520927.1.1916 WP_000520927.1.19168 WP_000520927.1.19292 WP_000520927.1.19339 WP_000520927.1.19396 WP_000520927.1.19531 WP_000520927.1.19670 WP_000520927.1.19826 WP_000520927.1.19877 WP_000520927.1.1995 WP_000520927.1.20044 WP_000520927.1.20120 WP_000520927.1.20176 WP_000520927.1.20194 WP_000520927.1.20306 WP_000520927.1.2033 WP_000520927.1.20359 WP_000520927.1.20444 WP_000520927.1.20534 WP_000520927.1.20541 WP_000520927.1.20571 WP_000520927.1.20656 WP_000520927.1.20748 WP_000520927.1.20816 WP_000520927.1.20817 WP_000520927.1.20830 WP_000520927.1.20889 WP_000520927.1.20998 WP_000520927.1.21032 WP_000520927.1.21112 WP_000520927.1.21190 WP_000520927.1.21337 WP_000520927.1.21484 WP_000520927.1.21546 WP_000520927.1.21662 WP_000520927.1.21689 WP_000520927.1.21738 WP_000520927.1.21747 WP_000520927.1.21939 WP_000520927.1.22053 WP_000520927.1.22108 WP_000520927.1.22209 WP_000520927.1.22286 WP_000520927.1.22301 WP_000520927.1.22469 WP_000520927.1.22586 WP_000520927.1.22687 WP_000520927.1.23023 WP_000520927.1.23141 WP_000520927.1.23173 WP_000520927.1.23234 WP_000520927.1.23243 WP_000520927.1.23328 WP_000520927.1.23401 WP_000520927.1.23636 WP_000520927.1.23651 WP_000520927.1.2386 WP_000520927.1.23997 WP_000520927.1.24015 WP_000520927.1.24041 WP_000520927.1.24097 WP_000520927.1.24105 WP_000520927.1.24152 WP_000520927.1.24178 WP_000520927.1.24260 WP_000520927.1.24358 WP_000520927.1.24449 WP_000520927.1.2445 WP_000520927.1.24545 WP_000520927.1.24611 WP_000520927.1.24706 WP_000520927.1.24750 WP_000520927.1.24927 WP_000520927.1.25091 WP_000520927.1.25143 WP_000520927.1.25263 WP_000520927.1.25292 WP_000520927.1.25478 WP_000520927.1.25519 WP_000520927.1.25560 WP_000520927.1.2559 WP_000520927.1.2561 WP_000520927.1.25689 WP_000520927.1.25723 WP_000520927.1.25850 WP_000520927.1.25971 WP_000520927.1.26181 WP_000520927.1.26204 WP_000520927.1.2626 WP_000520927.1.26352 WP_000520927.1.26425 WP_000520927.1.26472 WP_000520927.1.26504 WP_000520927.1.26528 WP_000520927.1.26647 WP_000520927.1.26649 WP_000520927.1.26669 WP_000520927.1.26715 WP_000520927.1.26744 WP_000520927.1.27059 WP_000520927.1.27109 WP_000520927.1.27176 WP_000520927.1.27265 WP_000520927.1.27270 WP_000520927.1.273 WP_000520927.1.2730 WP_000520927.1.27346 WP_000520927.1.2738 WP_000520927.1.27506 WP_000520927.1.27509 WP_000520927.1.2762 WP_000520927.1.2769 WP_000520927.1.27704 WP_000520927.1.27731 WP_000520927.1.27801 WP_000520927.1.27845 WP_000520927.1.27852 WP_000520927.1.27934 WP_000520927.1.27983 WP_000520927.1.28048 WP_000520927.1.28101 WP_000520927.1.28141 WP_000520927.1.28204 WP_000520927.1.28320 WP_000520927.1.28385 WP_000520927.1.28405 WP_000520927.1.28411 WP_000520927.1.28456 WP_000520927.1.28507 WP_000520927.1.28601 WP_000520927.1.28677 WP_000520927.1.28883 WP_000520927.1.28898 WP_000520927.1.28937 WP_000520927.1.28988 WP_000520927.1.29117 WP_000520927.1.29216 WP_000520927.1.29229 WP_000520927.1.29347 WP_000520927.1.29434 WP_000520927.1.29455 WP_000520927.1.29552 WP_000520927.1.2979 WP_000520927.1.29806 WP_000520927.1.29817 WP_000520927.1.29824 WP_000520927.1.29897 WP_000520927.1.30083 WP_000520927.1.30161 WP_000520927.1.30309 WP_000520927.1.30407 WP_000520927.1.30490 WP_000520927.1.30611 WP_000520927.1.30667 WP_000520927.1.30673 WP_000520927.1.30776 WP_000520927.1.30856 WP_000520927.1.30932 WP_000520927.1.30969 WP_000520927.1.30978 WP_000520927.1.30996 WP_000520927.1.31141 WP_000520927.1.3116 WP_000520927.1.31328 WP_000520927.1.31430 WP_000520927.1.3144 WP_000520927.1.3162 WP_000520927.1.31729 WP_000520927.1.31810 WP_000520927.1.3198 WP_000520927.1.31980 WP_000520927.1.32028 WP_000520927.1.32129 WP_000520927.1.32257 WP_000520927.1.32272 WP_000520927.1.32374 WP_000520927.1.32386 WP_000520927.1.32487 WP_000520927.1.32579 WP_000520927.1.32773 WP_000520927.1.3280 WP_000520927.1.32830 WP_000520927.1.32845 WP_000520927.1.32847 WP_000520927.1.32956 WP_000520927.1.3303 WP_000520927.1.33104 WP_000520927.1.33154 WP_000520927.1.33198 WP_000520927.1.33262 WP_000520927.1.33370 WP_000520927.1.33386 WP_000520927.1.33447 WP_000520927.1.3346 WP_000520927.1.33495 WP_000520927.1.33541 WP_000520927.1.33558 WP_000520927.1.33679 WP_000520927.1.33714 WP_000520927.1.33777 WP_000520927.1.33805 WP_000520927.1.33869 WP_000520927.1.33902 WP_000520927.1.33929 WP_000520927.1.33931 WP_000520927.1.33978 WP_000520927.1.33999 WP_000520927.1.34045 WP_000520927.1.34049 WP_000520927.1.34394 WP_000520927.1.34618 WP_000520927.1.34642 WP_000520927.1.34859 WP_000520927.1.35018 WP_000520927.1.35046 WP_000520927.1.35250 WP_000520927.1.35327 WP_000520927.1.3535 WP_000520927.1.35461 WP_000520927.1.35558 WP_000520927.1.35588 WP_000520927.1.35601 WP_000520927.1.35715 WP_000520927.1.35717 WP_000520927.1.35728 WP_000520927.1.35761 WP_000520927.1.35828 WP_000520927.1.36355 WP_000520927.1.36359 WP_000520927.1.36517 WP_000520927.1.36549 WP_000520927.1.36694 WP_000520927.1.36714 WP_000520927.1.36866 WP_000520927.1.36869 WP_000520927.1.36882 WP_000520927.1.36909 WP_000520927.1.36938 WP_000520927.1.37437 WP_000520927.1.3758 WP_000520927.1.37603 WP_000520927.1.37607 WP_000520927.1.37680 WP_000520927.1.37893 WP_000520927.1.37963 WP_000520927.1.38009 WP_000520927.1.38249 WP_000520927.1.38320 WP_000520927.1.3837 WP_000520927.1.3861 WP_000520927.1.38628 WP_000520927.1.38696 WP_000520927.1.38732 WP_000520927.1.38748 WP_000520927.1.38901 WP_000520927.1.38964 WP_000520927.1.39019 WP_000520927.1.39353 WP_000520927.1.39399 WP_000520927.1.39598 WP_000520927.1.39680 WP_000520927.1.39688 WP_000520927.1.397 WP_000520927.1.39911 WP_000520927.1.40199 WP_000520927.1.40225 WP_000520927.1.40233 WP_000520927.1.40297 WP_000520927.1.40332 WP_000520927.1.40645 WP_000520927.1.40679 WP_000520927.1.40832 WP_000520927.1.40836 WP_000520927.1.4086 WP_000520927.1.40864 WP_000520927.1.40947 WP_000520927.1.41029 WP_000520927.1.41059 WP_000520927.1.41201 WP_000520927.1.41266 WP_000520927.1.41395 WP_000520927.1.41425 WP_000520927.1.41546 WP_000520927.1.4164 WP_000520927.1.41707 WP_000520927.1.41720 WP_000520927.1.41738 WP_000520927.1.41777 WP_000520927.1.41838 WP_000520927.1.41922 WP_000520927.1.41934 WP_000520927.1.41936 WP_000520927.1.42080 WP_000520927.1.42172 WP_000520927.1.42253 WP_000520927.1.42289 WP_000520927.1.42351 WP_000520927.1.42401 WP_000520927.1.42484 WP_000520927.1.42531 WP_000520927.1.42561 WP_000520927.1.42571 WP_000520927.1.42708 WP_000520927.1.4277 WP_000520927.1.4281 WP_000520927.1.42824 WP_000520927.1.42888 WP_000520927.1.42928 WP_000520927.1.43011 WP_000520927.1.43094 WP_000520927.1.431 WP_000520927.1.4311 WP_000520927.1.43175 WP_000520927.1.43194 WP_000520927.1.43203 WP_000520927.1.43227 WP_000520927.1.43340 WP_000520927.1.43439 WP_000520927.1.43641 WP_000520927.1.43645 WP_000520927.1.43751 WP_000520927.1.43759 WP_000520927.1.4396 WP_000520927.1.43978 WP_000520927.1.44009 WP_000520927.1.44275 WP_000520927.1.44342 WP_000520927.1.44370 WP_000520927.1.44372 WP_000520927.1.44407 WP_000520927.1.44613 WP_000520927.1.44664 WP_000520927.1.44684 WP_000520927.1.44809 WP_000520927.1.44816 WP_000520927.1.44886 WP_000520927.1.44926 WP_000520927.1.44929 WP_000520927.1.44944 WP_000520927.1.44974 WP_000520927.1.44991 WP_000520927.1.45149 WP_000520927.1.45233 WP_000520927.1.45291 WP_000520927.1.45350 WP_000520927.1.4537 WP_000520927.1.45399 WP_000520927.1.45418 WP_000520927.1.45457 WP_000520927.1.45608 WP_000520927.1.45637 WP_000520927.1.45647 WP_000520927.1.45675 WP_000520927.1.45761 WP_000520927.1.45839 WP_000520927.1.45916 WP_000520927.1.46138 WP_000520927.1.46255 WP_000520927.1.46338 WP_000520927.1.46385 WP_000520927.1.46413 WP_000520927.1.46474 WP_000520927.1.4648 WP_000520927.1.46577 WP_000520927.1.46762 WP_000520927.1.46774 WP_000520927.1.46827 WP_000520927.1.46850 WP_000520927.1.46918 WP_000520927.1.46950 WP_000520927.1.46959 WP_000520927.1.47241 WP_000520927.1.47298 WP_000520927.1.47388 WP_000520927.1.47515 WP_000520927.1.47543 WP_000520927.1.47552 WP_000520927.1.47573 WP_000520927.1.47715 WP_000520927.1.47816 WP_000520927.1.47828 WP_000520927.1.47903 WP_000520927.1.48042 WP_000520927.1.48115 WP_000520927.1.4819 WP_000520927.1.4824 WP_000520927.1.48270 WP_000520927.1.48280 WP_000520927.1.48380 WP_000520927.1.48457 WP_000520927.1.48495 WP_000520927.1.48509 WP_000520927.1.48529 WP_000520927.1.48642 WP_000520927.1.48692 WP_000520927.1.48700 WP_000520927.1.48824 WP_000520927.1.4887 WP_000520927.1.489 WP_000520927.1.49083 WP_000520927.1.4911 WP_000520927.1.49318 WP_000520927.1.4935 WP_000520927.1.49380 WP_000520927.1.49405 WP_000520927.1.4941 WP_000520927.1.49564 WP_000520927.1.49639 WP_000520927.1.4967 WP_000520927.1.49789 WP_000520927.1.49849 WP_000520927.1.49866 WP_000520927.1.49896 WP_000520927.1.49928 WP_000520927.1.49960 WP_000520927.1.50011 WP_000520927.1.50097 WP_000520927.1.50208 WP_000520927.1.50223 WP_000520927.1.50267 WP_000520927.1.50298 WP_000520927.1.503 WP_000520927.1.50617 WP_000520927.1.50641 WP_000520927.1.50705 WP_000520927.1.50789 WP_000520927.1.50815 WP_000520927.1.50859 WP_000520927.1.50867 WP_000520927.1.50872 WP_000520927.1.51063 WP_000520927.1.51328 WP_000520927.1.51369 WP_000520927.1.51437 WP_000520927.1.51569 WP_000520927.1.51578 WP_000520927.1.51597 WP_000520927.1.51640 WP_000520927.1.51663 WP_000520927.1.5171 WP_000520927.1.51856 WP_000520927.1.51861 WP_000520927.1.51966 WP_000520927.1.52032 WP_000520927.1.52103 WP_000520927.1.52138 WP_000520927.1.52189 WP_000520927.1.5220 WP_000520927.1.52392 WP_000520927.1.52445 WP_000520927.1.52619 WP_000520927.1.5274 WP_000520927.1.52779 WP_000520927.1.5281 WP_000520927.1.52839 WP_000520927.1.52840 WP_000520927.1.52885 WP_000520927.1.52980 WP_000520927.1.52982 WP_000520927.1.53023 WP_000520927.1.53052 WP_000520927.1.53097 WP_000520927.1.53146 WP_000520927.1.53331 WP_000520927.1.53390 WP_000520927.1.53424 WP_000520927.1.53498 WP_000520927.1.53533 WP_000520927.1.53616 WP_000520927.1.53708 WP_000520927.1.53762 WP_000520927.1.53854 WP_000520927.1.53954 WP_000520927.1.54 WP_000520927.1.54055 WP_000520927.1.54088 WP_000520927.1.5412 WP_000520927.1.54139 WP_000520927.1.54242 WP_000520927.1.54266 WP_000520927.1.54361 WP_000520927.1.54451 WP_000520927.1.54581 WP_000520927.1.54664 WP_000520927.1.5489 WP_000520927.1.54963 WP_000520927.1.55096 WP_000520927.1.55201 WP_000520927.1.55321 WP_000520927.1.55363 WP_000520927.1.55368 WP_000520927.1.55376 WP_000520927.1.55516 WP_000520927.1.55638 WP_000520927.1.55799 WP_000520927.1.55952 WP_000520927.1.55997 WP_000520927.1.56027 WP_000520927.1.56067 WP_000520927.1.56076 WP_000520927.1.56102 WP_000520927.1.56165 WP_000520927.1.56211 WP_000520927.1.56246 WP_000520927.1.56379 WP_000520927.1.56538 WP_000520927.1.56668 WP_000520927.1.56712 WP_000520927.1.56717 WP_000520927.1.56798 WP_000520927.1.5697 WP_000520927.1.56991 WP_000520927.1.57078 WP_000520927.1.57346 WP_000520927.1.57408 WP_000520927.1.57465 WP_000520927.1.57535 WP_000520927.1.57606 WP_000520927.1.57654 WP_000520927.1.5769 WP_000520927.1.5780 WP_000520927.1.57829 WP_000520927.1.57874 WP_000520927.1.58061 WP_000520927.1.5822 WP_000520927.1.58269 WP_000520927.1.58453 WP_000520927.1.58621 WP_000520927.1.58969 WP_000520927.1.590 WP_000520927.1.5908 WP_000520927.1.59107 WP_000520927.1.59325 WP_000520927.1.59416 WP_000520927.1.59476 WP_000520927.1.59488 WP_000520927.1.59522 WP_000520927.1.5961 WP_000520927.1.59649 WP_000520927.1.59754 WP_000520927.1.59957 WP_000520927.1.600 WP_000520927.1.60108 WP_000520927.1.60116 WP_000520927.1.60176 WP_000520927.1.60198 WP_000520927.1.60243 WP_000520927.1.60299 WP_000520927.1.60316 WP_000520927.1.60318 WP_000520927.1.60359 WP_000520927.1.60474 WP_000520927.1.60581 WP_000520927.1.60589 WP_000520927.1.60655 WP_000520927.1.60669 WP_000520927.1.60697 WP_000520927.1.61105 WP_000520927.1.61291 WP_000520927.1.61410 WP_000520927.1.61452 WP_000520927.1.61477 WP_000520927.1.61527 WP_000520927.1.61578 WP_000520927.1.61637 WP_000520927.1.61704 WP_000520927.1.61974 WP_000520927.1.62011 WP_000520927.1.62067 WP_000520927.1.62150 WP_000520927.1.62308 WP_000520927.1.62368 WP_000520927.1.624 WP_000520927.1.62428 WP_000520927.1.62543 WP_000520927.1.62767 WP_000520927.1.6277 WP_000520927.1.62924 WP_000520927.1.62935 WP_000520927.1.63028 WP_000520927.1.63219 WP_000520927.1.63274 WP_000520927.1.63303 WP_000520927.1.63340 WP_000520927.1.63405 WP_000520927.1.63426 WP_000520927.1.63429 WP_000520927.1.6352 WP_000520927.1.63636 WP_000520927.1.63681 WP_000520927.1.63857 WP_000520927.1.64214 WP_000520927.1.64310 WP_000520927.1.64428 WP_000520927.1.64465 WP_000520927.1.64604 WP_000520927.1.64639 WP_000520927.1.64834 WP_000520927.1.64907 WP_000520927.1.64964 WP_000520927.1.65003 WP_000520927.1.65005 WP_000520927.1.65058 WP_000520927.1.6513 WP_000520927.1.65325 WP_000520927.1.65342 WP_000520927.1.65373 WP_000520927.1.65496 WP_000520927.1.65560 WP_000520927.1.65592 WP_000520927.1.65630 WP_000520927.1.65680 WP_000520927.1.65804 WP_000520927.1.65866 WP_000520927.1.65890 WP_000520927.1.65955 WP_000520927.1.65995 WP_000520927.1.66140 WP_000520927.1.66142 WP_000520927.1.66215 WP_000520927.1.66431 WP_000520927.1.66458 WP_000520927.1.66491 WP_000520927.1.66496 WP_000520927.1.66541 WP_000520927.1.66591 WP_000520927.1.66636 WP_000520927.1.66689 WP_000520927.1.66716 WP_000520927.1.66717 WP_000520927.1.66782 WP_000520927.1.66806 WP_000520927.1.66899 WP_000520927.1.67009 WP_000520927.1.67361 WP_000520927.1.67486 WP_000520927.1.67500 WP_000520927.1.67601 WP_000520927.1.67656 WP_000520927.1.6767 WP_000520927.1.67862 WP_000520927.1.67869 WP_000520927.1.67895 WP_000520927.1.67922 WP_000520927.1.68065 WP_000520927.1.68087 WP_000520927.1.68119 WP_000520927.1.68132 WP_000520927.1.68168 WP_000520927.1.6820 WP_000520927.1.68225 WP_000520927.1.68315 WP_000520927.1.6841 WP_000520927.1.68428 WP_000520927.1.68454 WP_000520927.1.6851 WP_000520927.1.6861 WP_000520927.1.68698 WP_000520927.1.68830 WP_000520927.1.68837 WP_000520927.1.68858 WP_000520927.1.68885 WP_000520927.1.689 WP_000520927.1.68930 WP_000520927.1.69117 WP_000520927.1.69121 WP_000520927.1.69172 WP_000520927.1.69193 WP_000520927.1.69364 WP_000520927.1.69379 WP_000520927.1.69419 WP_000520927.1.69478 WP_000520927.1.6952 WP_000520927.1.69586 WP_000520927.1.69665 WP_000520927.1.69815 WP_000520927.1.69929 WP_000520927.1.69930 WP_000520927.1.70025 WP_000520927.1.70154 WP_000520927.1.70197 WP_000520927.1.70283 WP_000520927.1.70827 WP_000520927.1.70891 WP_000520927.1.71151 WP_000520927.1.71168 WP_000520927.1.71204 WP_000520927.1.71220 WP_000520927.1.71335 WP_000520927.1.71413 WP_000520927.1.71539 WP_000520927.1.71719 WP_000520927.1.71823 WP_000520927.1.71825 WP_000520927.1.71960 WP_000520927.1.71969 WP_000520927.1.71971 WP_000520927.1.7213 WP_000520927.1.72265 WP_000520927.1.72295 WP_000520927.1.72317 WP_000520927.1.72334 WP_000520927.1.72430 WP_000520927.1.7244 WP_000520927.1.72538 WP_000520927.1.73076 WP_000520927.1.73341 WP_000520927.1.73348 WP_000520927.1.73375 WP_000520927.1.73434 WP_000520927.1.73446 WP_000520927.1.73542 WP_000520927.1.73645 WP_000520927.1.73699 WP_000520927.1.73727 WP_000520927.1.73806 WP_000520927.1.73867 WP_000520927.1.73875 WP_000520927.1.73932 WP_000520927.1.74122 WP_000520927.1.74463 WP_000520927.1.7453 WP_000520927.1.74700 WP_000520927.1.74709 WP_000520927.1.74711 WP_000520927.1.74869 WP_000520927.1.74930 WP_000520927.1.75105 WP_000520927.1.75107 WP_000520927.1.75121 WP_000520927.1.7521 WP_000520927.1.75212 WP_000520927.1.75225 WP_000520927.1.75386 WP_000520927.1.75459 WP_000520927.1.75489 WP_000520927.1.75562 WP_000520927.1.75569 WP_000520927.1.75738 WP_000520927.1.75812 WP_000520927.1.75859 WP_000520927.1.75895 WP_000520927.1.76026 WP_000520927.1.7606 WP_000520927.1.76117 WP_000520927.1.76250 WP_000520927.1.76260 WP_000520927.1.76372 WP_000520927.1.76464 WP_000520927.1.76493 WP_000520927.1.76523 WP_000520927.1.76587 WP_000520927.1.7662 WP_000520927.1.76682 WP_000520927.1.76698 WP_000520927.1.76809 WP_000520927.1.76871 WP_000520927.1.76981 WP_000520927.1.77257 WP_000520927.1.77274 WP_000520927.1.77347 WP_000520927.1.77539 WP_000520927.1.77711 WP_000520927.1.77758 WP_000520927.1.77815 WP_000520927.1.77891 WP_000520927.1.77903 WP_000520927.1.7791 WP_000520927.1.77996 WP_000520927.1.78042 WP_000520927.1.78154 WP_000520927.1.7816 WP_000520927.1.78240 WP_000520927.1.7825 WP_000520927.1.78261 WP_000520927.1.78263 WP_000520927.1.78505 WP_000520927.1.7864 WP_000520927.1.7866 WP_000520927.1.78660 WP_000520927.1.78769 WP_000520927.1.78783 WP_000520927.1.78805 WP_000520927.1.78808 WP_000520927.1.79010 WP_000520927.1.79028 WP_000520927.1.79072 WP_000520927.1.79078 WP_000520927.1.7908 WP_000520927.1.79181 WP_000520927.1.79229 WP_000520927.1.79261 WP_000520927.1.79284 WP_000520927.1.79328 WP_000520927.1.7938 WP_000520927.1.79567 WP_000520927.1.79701 WP_000520927.1.79720 WP_000520927.1.79728 WP_000520927.1.79736 WP_000520927.1.79774 WP_000520927.1.7978 WP_000520927.1.79889 WP_000520927.1.79909 WP_000520927.1.79938 WP_000520927.1.80121 WP_000520927.1.80125 WP_000520927.1.80143 WP_000520927.1.80195 WP_000520927.1.8021 WP_000520927.1.80665 WP_000520927.1.80730 WP_000520927.1.80766 WP_000520927.1.80887 WP_000520927.1.80897 WP_000520927.1.80997 WP_000520927.1.81002 WP_000520927.1.81068 WP_000520927.1.81161 WP_000520927.1.81240 WP_000520927.1.81253 WP_000520927.1.81319 WP_000520927.1.81345 WP_000520927.1.81373 WP_000520927.1.81441 WP_000520927.1.81466 WP_000520927.1.81700 WP_000520927.1.81704 WP_000520927.1.81764 WP_000520927.1.82039 WP_000520927.1.82040 WP_000520927.1.82110 WP_000520927.1.82235 WP_000520927.1.82286 WP_000520927.1.8230 WP_000520927.1.82366 WP_000520927.1.82453 WP_000520927.1.82504 WP_000520927.1.82786 WP_000520927.1.82809 WP_000520927.1.82848 WP_000520927.1.82861 WP_000520927.1.8301 WP_000520927.1.83178 WP_000520927.1.83400 WP_000520927.1.83410 WP_000520927.1.83450 WP_000520927.1.83474 WP_000520927.1.83594 WP_000520927.1.836 WP_000520927.1.83693 WP_000520927.1.8377 WP_000520927.1.838 WP_000520927.1.83889 WP_000520927.1.84012 WP_000520927.1.84058 WP_000520927.1.84139 WP_000520927.1.84247 WP_000520927.1.84250 WP_000520927.1.84308 WP_000520927.1.84447 WP_000520927.1.84490 WP_000520927.1.84527 WP_000520927.1.84536 WP_000520927.1.84571 WP_000520927.1.84618 WP_000520927.1.84688 WP_000520927.1.84691 WP_000520927.1.84706 WP_000520927.1.84769 WP_000520927.1.84864 WP_000520927.1.84898 WP_000520927.1.84921 WP_000520927.1.84944 WP_000520927.1.85149 WP_000520927.1.85168 WP_000520927.1.85185 WP_000520927.1.85299 WP_000520927.1.85364 WP_000520927.1.85468 WP_000520927.1.85472 WP_000520927.1.85493 WP_000520927.1.85544 WP_000520927.1.85716 WP_000520927.1.85743 WP_000520927.1.85833 WP_000520927.1.85846 WP_000520927.1.8601 WP_000520927.1.86100 WP_000520927.1.86163 WP_000520927.1.86242 WP_000520927.1.86277 WP_000520927.1.86324 WP_000520927.1.86385 WP_000520927.1.86536 WP_000520927.1.86715 WP_000520927.1.86890 WP_000520927.1.86908 WP_000520927.1.86922 WP_000520927.1.86966 WP_000520927.1.86973 WP_000520927.1.86976 WP_000520927.1.87048 WP_000520927.1.87111 WP_000520927.1.87567 WP_000520927.1.87688 WP_000520927.1.87727 WP_000520927.1.87830 WP_000520927.1.88109 WP_000520927.1.88115 WP_000520927.1.88131 WP_000520927.1.88133 WP_000520927.1.88163 WP_000520927.1.88183 WP_000520927.1.88512 WP_000520927.1.88596 WP_000520927.1.8860 WP_000520927.1.88613 WP_000520927.1.88654 WP_000520927.1.88842 WP_000520927.1.88956 WP_000520927.1.89172 WP_000520927.1.89199 WP_000520927.1.89209 WP_000520927.1.89218 WP_000520927.1.89289 WP_000520927.1.89376 WP_000520927.1.89383 WP_000520927.1.89419 WP_000520927.1.89459 WP_000520927.1.89484 WP_000520927.1.89568 WP_000520927.1.89611 WP_000520927.1.89653 WP_000520927.1.89685 WP_000520927.1.89790 WP_000520927.1.89792 WP_000520927.1.89836 WP_000520927.1.89906 WP_000520927.1.90087 WP_000520927.1.90118 WP_000520927.1.90132 WP_000520927.1.90262 WP_000520927.1.90375 WP_000520927.1.90378 WP_000520927.1.9038 WP_000520927.1.90413 WP_000520927.1.90704 WP_000520927.1.90755 WP_000520927.1.90781 WP_000520927.1.90932 WP_000520927.1.90953 WP_000520927.1.91085 WP_000520927.1.91147 WP_000520927.1.91206 WP_000520927.1.91249 WP_000520927.1.91286 WP_000520927.1.9134 WP_000520927.1.91355 WP_000520927.1.91477 WP_000520927.1.91502 WP_000520927.1.91696 WP_000520927.1.91762 WP_000520927.1.91780 WP_000520927.1.91789 WP_000520927.1.91854 WP_000520927.1.91908 WP_000520927.1.91941 WP_000520927.1.91998 WP_000520927.1.9228 WP_000520927.1.9233 WP_000520927.1.92417 WP_000520927.1.92515 WP_000520927.1.92687 WP_000520927.1.92749 WP_000520927.1.92830 WP_000520927.1.92998 WP_000520927.1.9309 WP_000520927.1.93094 WP_000520927.1.93114 WP_000520927.1.93151 WP_000520927.1.93451 WP_000520927.1.93580 WP_000520927.1.93778 WP_000520927.1.93796 WP_000520927.1.93849 WP_000520927.1.93868 WP_000520927.1.93948 WP_000520927.1.93991 WP_000520927.1.94034 WP_000520927.1.94144 WP_000520927.1.94265 WP_000520927.1.94387 WP_000520927.1.94410 WP_000520927.1.94725 WP_000520927.1.94740 WP_000520927.1.94900 WP_000520927.1.94948 WP_000520927.1.95026 WP_000520927.1.95040 WP_000520927.1.95092 WP_000520927.1.95109 WP_000520927.1.95111 WP_000520927.1.95220 WP_000520927.1.95260 WP_000520927.1.95269 WP_000520927.1.9536 WP_000520927.1.95539 WP_000520927.1.95622 WP_000520927.1.95665 WP_000520927.1.95755 WP_000520927.1.95844 WP_000520927.1.95859 WP_000520927.1.95873 WP_000520927.1.95923 WP_000520927.1.9593 WP_000520927.1.96029 WP_000520927.1.96046 WP_000520927.1.96323 WP_000520927.1.9645 WP_000520927.1.96598 WP_000520927.1.96696 WP_000520927.1.96747 WP_000520927.1.96930 WP_000520927.1.96942 WP_000520927.1.96998 WP_000520927.1.97032 WP_000520927.1.9714 WP_000520927.1.97163 WP_000520927.1.9733 WP_000520927.1.97520 WP_000520927.1.97709 WP_000520927.1.97710 WP_000520927.1.97780 WP_000520927.1.97844 WP_000520927.1.97893 WP_000520927.1.97920 WP_000520927.1.9794 WP_000520927.1.98068 WP_000520927.1.98150 WP_000520927.1.98224 WP_000520927.1.98272 WP_000520927.1.9832 WP_000520927.1.98354 WP_000520927.1.98434 WP_000520927.1.98523 WP_000520927.1.98561 WP_000520927.1.98625 WP_000520927.1.98691 WP_000520927.1.98692 WP_000520927.1.987 WP_000520927.1.98806 WP_000520927.1.98835 WP_000520927.1.98919 WP_000520927.1.98950 WP_000520927.1.98986 WP_000520927.1.98998 WP_000520927.1.99048 WP_000520927.1.99049 WP_000520927.1.99162 WP_000520927.1.99188 WP_000520927.1.99250 WP_000520927.1.99391 WP_000520927.1.99420 WP_000520927.1.99449 WP_000520927.1.9952 WP_000520927.1.99555 WP_000520927.1.99653 WP_000520927.1.99775 WP_000520927.1.99825 WP_000520927.1.99833 WP_000520927.1.99868 WP_000520927.1.99964 WP_000520927.1.9997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]