SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|563707258|ref|YP_008871862.1| from Babela massiliensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|563707258|ref|YP_008871862.1|
Domain Number 1 Region: 162-381
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.46e-84
Family ATP sulfurylase catalytic domain 0.00000029
Further Details:      
 
Domain Number 2 Region: 24-161
Classification Level Classification E-value
Superfamily PUA domain-like 1.99e-40
Family ATP sulfurylase N-terminal domain 0.0000205
Further Details:      
 
Domain Number 3 Region: 383-555
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.97e-34
Family ATP sulfurylase C-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|563707258|ref|YP_008871862.1|
Sequence length 560
Comment bifunctional sulfate adenylyltransferase [delta proteobacterium BABL1]
Sequence
MVIKRYYIFQLISIFFVNLYINANYLVLTTRQLCDLELILNNGFAPLKTFMNQKDYESVI
LNMRLTDNTVWPIPIMLDVDQQTIKTLKDNNSRLILKHPEGHELALLEVNEIWKPNKEIE
AINVYGTTNIEHPGVNYLLNSTKEYYISGKLTKIRLPKHYDFTDLRKTPEDLKSYFKEKG
ITKVVGFQTRNPMHKAHKELTSRAAQSTNAHLLIHPVVGQTKPGDVDHFTRVRCYKQLLK
YYPQDSVTLSLLPISMRMAGPREALWHAIIRKNYGCTHFIIGRDHAGPGKDSSGKDFYGP
YDAQNLVKQYEKEIGINILLFNEMVYSVDQNTYKPENEIESNEKILRISGTQLRQLLKEA
KEIPGWFTYPEIAQELKKSYPPKFKQGFTIFFTGLPSSGKSTIANALAIKLSEIQNRLIT
VLDGDLIRNHLSKELGFSKEHRSINVQRVGFVANEITKNGGVAICALIAPYEQDRRYNRE
LITRGGYIEVYVSTPLNVCQERDEKGLYAKAKEGKIEMLTGISDPYESPKNPEITIDTST
LSVEECIEQIINHLKLEQYI
Download sequence
Identical sequences V6DGR0
gi|563707258|ref|YP_008871862.1| WP_023792392.1.71942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]