SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|380032941|ref|YP_004889932.1| from Lactobacillus plantarum WCFS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|380032941|ref|YP_004889932.1|
Domain Number 1 Region: 207-600
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.63e-86
Family beta-Lactamase/D-ala carboxypeptidase 0.000000454
Further Details:      
 
Domain Number 2 Region: 66-250
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.03e-35
Family Penicillin binding protein dimerisation domain 0.0000401
Further Details:      
 
Domain Number 3 Region: 598-656
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0046
Further Details:      
 
Domain Number 4 Region: 659-712
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000916
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|380032941|ref|YP_004889932.1|
Sequence length 713
Comment transpeptidase, penicillin binding protein 2B [Lactobacillus plantarum WCFS1]
Sequence
MNKNKQRMTSKRSPKQNRRIFGQWLFFGAIAVFGVLIIRFSYIAIVRHVNGVNLVEATKK
LYTEDQTITAKRGTIYTANGDPIAEDTSTYTVYAIMAKNQQSASGKALYVKNNAKAARVL
SKYLPISYKKALATLQKGAGKFQIEFGTAGKNISLTTKEKIDAQNVAGLHFIESEARLYP
NGTFASHLVGLTTSKSQKDTDQTRLTGSMGIELAFNKQLSGTDGRKTITKSGYQGSTETG
KKVKDGDNIYTTIDSKLQTLLETKVSQVNAKVSPKSMTATLMNAKTGAILATTQRPTFNA
QTKTGLSKMWRNLLVEDTYEPGSTMKVFTMAAAIDSGKYNANVTVPTGEYKIGNNTVPDW
NTSGWGNITYAKGFALSSNTAMAHLEQAMGAKAWLKYIKRFGLRESTNSGLDNEQSGSIQ
FTYPIEQADTAFGQGIQVTAMQMLRGFTAIANHGKMLQPYFISKITNPNTNKTVYTGKKK
VVSQPISSKTASKVLDHMQDVVYKSYGTGSSYKISGYRIAAKTGTAQVSNGSTYEQGDNT
YLYSVVGMAPAKNPKYIMYITMKQPTLNGSSASDDMAEIFDTVMKRALEEQKASETKATT
IKMKDLTSKSTSAAKKAAKKQGLDVVVVGKGSRVVKQSISSGTVVSSGQRVILVTNGQMY
MPNLSGWSASEVADFATLTGVKLTTSGTGYVKTQSVTAGNPIEAKQAISVTLK
Download sequence
Identical sequences F9UQC9
220668.lp_2200 WP_011101681.1.57 YP_004889932.1.96219 gi|380032941|ref|YP_004889932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]