SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|104774276|ref|YP_619256.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|104774276|ref|YP_619256.1|
Domain Number 1 Region: 15-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-84
Family Protein kinases, catalytic subunit 0.00000215
Further Details:      
 
Weak hits

Sequence:  gi|104774276|ref|YP_619256.1|
Domain Number - Region: 512-572
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number - Region: 430-483
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00785
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 361-422
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0128
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|104774276|ref|YP_619256.1|
Sequence length 674
Comment Serine/threonine protein kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
Sequence
MRRMARVINKGYLLGDRYRIVDTLGEGGMANVYLADDIILKRQVAVKIIRLDLQKDSQVL
ARFQREALATSELSHPNIVSVFDVGTDHGLPYMVMEYVKGPDLKEYIREKSPIPLPQVIK
IMDQILSAMELAHKHNVIHRDLKPQNILMDEKGNIKIADFGIAVALNQSAITQTNSVLGS
VHYMSPEQTRGGMVTKQSDIYSLGIILYEALTGHVPFNGETPVAIALKHAEDDIPSLRKQ
NKAIPQALENVVLKATAKDPRDRYASVAEMKADLDSSLDPSRAGEAIYRPSHGNNDETKI
LPALNGKVMQAEKAKEGKAEEPKKRSFWASIKKYKWWWIGSLFPVFAILLFMFLAVGHNN
VRVPDVVNMTEKAAKTSLKSSGLAVGAVKRTYSSDVKKGKVISTTPKANSPVDKGGKVNL
LVSKGSNLTKVPDVEGLYLSTAKKKLNKLGFKVKSREAPSNEYLPGLIISQSVKAGRKVD
ASKTTITLVVAVALEDQPKPSSSSSSKKATFKLADLTGKSLEDAQSYAKSKKLNVKVEKD
HSDSVDSGDVIYTDPAAGSEVSEGDTLTITVSKGAEKKEVKKTFTVDYQAAESSSNSSES
SSSSSSSQGNHVRIYIQDDDHSLGNIYRDLYITKDTDFTITFSVTKGDGKIKIVRDDQTV
VDETISADDSESGN
Download sequence
Identical sequences Q1G9I4
gi|104774276|ref|YP_619256.1| WP_011544038.1.11778 WP_011544038.1.43242 390333.Ldb1409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]