SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|104774136|ref|YP_619116.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|104774136|ref|YP_619116.1|
Domain Number 1 Region: 448-467,501-752
Classification Level Classification E-value
Superfamily HAD-like 5.04e-53
Family Meta-cation ATPase, catalytic domain P 0.00083
Further Details:      
 
Domain Number 2 Region: 257-351
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.48e-21
Family Calcium ATPase, transduction domain A 0.0049
Further Details:      
 
Domain Number 3 Region: 197-254,352-441
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000017
Family Calcium ATPase, transmembrane domain M 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|104774136|ref|YP_619116.1|
Sequence length 762
Comment cation transporting P-type ATPase ( copper transporter) [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
Sequence
MANKEDHMNMKNMSAKNMENKEDHMNMKNMSAKNMENNESNMCHMDHDMTETDHNQMNMD
HDMAETDHNQMNMDHDMAEMDHSQMNMNHGDMDMAGTDMMMHGGTMMHMGNLKVKFWVSV
VLAIPVLLLAPIMGLNVSILSFSSPLIVGIIIVLFDTALYFYGGMPFLKGAKAEIQNKSP
EMMTLVTLGISVSYFYSLYAFIANNFLNPANHVMDFSFELATLILIMLLGHWIEMNALMG
AGDALQKMAALLPKTAHLVTDNGETKEVPVSDLKVGQAFQVRSGESIPADGVITAGESTV
NEALVTGESAAVPKKVGDKVIGGATNNNGTLTVKISGTGDSGYLSQVMKMVKNAQQAKSK
AEDKADLVAKYLFYAAFSVGIIAFFAWLPQGLATAMTIMVTVFVIACPHALGLAIPLVVS
RSTTIGAQNGLLVRNRQAIEASQHVSHVLLDKTGTLTEGKFTVNALIPNDGIDETTLLSR
LAALESNSTHPLAQAIITEAQAKGIEVVAAEKSQNIPGVGISGNVDGTDYMIVNGNYLKK
QGIKFDEAAADKWAAKGNSVSFLLQGTQVQGMVAEGDTIKAGAKELISGLQKRGITPVML
TGDNPKAAEHVANLLGLTEFHAGLLPDDKQKIVADYQAKGNHVIMVGDGVNDAPSLAAAD
IGIAIGAGTDVAIDSADVVLVKSEPSDILHFLDLAKITNRKMVQNLWWGAGYNIVAIPLA
AGVLSFIGIILDPAVGAVVMAMSTIIVAINAMGLTAEKIKNV
Download sequence
Identical sequences Q1G9X4
gi|104774136|ref|YP_619116.1| 390333.Ldb1239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]