SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404487436|ref|YP_006711542.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404487436|ref|YP_006711542.1|
Domain Number 1 Region: 1-239
Classification Level Classification E-value
Superfamily Hsp33 domain 1.83e-78
Family Hsp33 domain 0.00000000456
Further Details:      
 
Domain Number 2 Region: 230-288
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 2.09e-21
Family HSP33 redox switch-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404487436|ref|YP_006711542.1|
Sequence length 289
Comment Hsp33-like chaperonin [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MDYLVKAIAYDGKVRAYAANTTETIHEAQRRHNTWPTASAALGRTMTAAVMLGAMLKGED
KLTVKIEGGGPIGAIVADGNAKGDVRGYVSNPHVHFDLNEHGKLDVRRAVGTSGTLSVVK
DLGLRDLFTGQVEIVSGEIGEDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFILQLL
PGTDDETITKLETNLSQVEPISKLIQKGLTPEEVLAAVLGEEPEVLETVPVRFTCNCSKE
RFARGIIGLGKDEIQQMIDEDGQAEAQCHFCNETYLFTKEELEALRDEI
Download sequence
Identical sequences A0A1Y0YN24 Q65PF0
WP_003178244.1.10695 WP_003178244.1.12567 WP_003178244.1.1290 WP_003178244.1.20727 WP_003178244.1.21456 WP_003178244.1.22930 WP_003178244.1.27377 WP_003178244.1.27603 WP_003178244.1.27836 WP_003178244.1.31090 WP_003178244.1.31877 WP_003178244.1.34504 WP_003178244.1.34863 WP_003178244.1.34956 WP_003178244.1.35726 WP_003178244.1.35764 WP_003178244.1.42641 WP_003178244.1.46361 WP_003178244.1.46635 WP_003178244.1.47006 WP_003178244.1.48016 WP_003178244.1.50447 WP_003178244.1.54544 WP_003178244.1.55910 WP_003178244.1.57471 WP_003178244.1.62441 WP_003178244.1.62618 WP_003178244.1.64701 WP_003178244.1.70162 WP_003178244.1.719 WP_003178244.1.71919 WP_003178244.1.7403 WP_003178244.1.74244 WP_003178244.1.8120 WP_003178244.1.85389 WP_003178244.1.8660 WP_003178244.1.86740 WP_003178244.1.86759 WP_003178244.1.94809 WP_003178244.1.9500 WP_003178244.1.95031 WP_003178244.1.9558 WP_003178244.1.96953 WP_003178244.1.98374 WP_003178244.1.99505 279010.BL00854 gi|52078566|ref|YP_077357.1| gi|404487436|ref|YP_006711542.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]