SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|404487980|ref|YP_006712086.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404487980|ref|YP_006712086.1|
Domain Number 1 Region: 130-291
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 8.02e-32
Family Rob transcription factor, C-terminal domain 0.085
Further Details:      
 
Domain Number 2 Region: 59-109
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000269
Family AraC type transcriptional activator 0.0029
Further Details:      
 
Domain Number 3 Region: 6-57
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000896
Family AraC type transcriptional activator 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404487980|ref|YP_006712086.1|
Sequence length 292
Comment HTH-type transcriptional regulator [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MNMNDYERIQNAVQFIEEHLQNDLNITDIAAKSCFSPFHFQRLFQAISGFSVYQYIRNRR
LSEAALLLEKTDRSILDIAINFGYGSQEAFSRAFSQYFGITPAKYRKAKVKLDFQSKINF
LEYKERMTGDMNIPKPHITHLNDIHMIGYEYRTNLNDEKYFEDIPKFYNDFGRNGYFMQI
PQKTDPNMCYGLSCRFQDDGGFSFIIGEAVRETAAGEVPEPLIYTKIPGGKYAVFHVNGS
TESVQNTRRYIYGSWLMNTNYERTEGPDFEVTDVCRSVPPNEMKMTIYIPLL
Download sequence
Identical sequences WP_009329152.1.1290 WP_009329152.1.21456 WP_009329152.1.27603 WP_009329152.1.34863 WP_009329152.1.34956 WP_009329152.1.35726 WP_009329152.1.47006 WP_009329152.1.55910 WP_009329152.1.719 WP_009329152.1.7403 WP_009329152.1.74244 WP_009329152.1.86740 WP_009329152.1.86759 gi|404487980|ref|YP_006712086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]