SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404488577|ref|YP_006712683.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404488577|ref|YP_006712683.1|
Domain Number 1 Region: 146-345
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.98e-59
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000515
Further Details:      
 
Domain Number 2 Region: 430-562
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000591
Further Details:      
 
Domain Number 3 Region: 13-145
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.11e-34
Family Duplicated SiR/NiR-like domains 1 and 3 0.0015
Further Details:      
 
Domain Number 4 Region: 347-423
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.76e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|404488577|ref|YP_006712683.1|
Sequence length 572
Comment sulfite reductase subunit beta [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MGNEILKAPEGPPSDVERIKKESDYLRGTLKESMLEPLSAGISDDDNRLMKHHGSYLQDD
RDLRNERQKQKLEPAYQFMLRVRMPGGVATPEQWLVMDELARKYGNGTLKLTTRETFQMH
GILKWNMKKTIQSIHSAMLDTIAACGDVNRNVMCTSNPYQSEIHREVYEWSKKLSDDLLP
RTRAYHEIWLDEEKVAGTPDADEVEPMYGPLYLPRKFKIGIAVPPSNDIDVFSQDLGFIA
IVEDDKLIGFNVAIGGGMGMTHGDKATYPQLAKVIGFCKPEQLYDVAEKTITIQRDYGNR
SVRKNARFKYTVDRLGLETVKNELENRLGWSLAEAKPYHFEHNGDRYGWVKGVKGRWHFT
MFVEGGRVTDYDDYKLMTGLREIAKVHTGDIRLTANQNLIIANVTSQKKKKISELIEQFG
LTDGKHYTALRRSSIACVALPTCGLAMAEAERYLPKLIDKIDEIVEENGLKNEEITIRMT
GCPNGCARHALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEEEILKELRNILPR
YAKERNEGERFGDFVIRAGIVKETTDGTNFHD
Download sequence
Identical sequences A0A2A5Z358 Q65L57 T5HJK3
gi|404488577|ref|YP_006712683.1| WP_003180762.1.10695 WP_003180762.1.1290 WP_003180762.1.20727 WP_003180762.1.21456 WP_003180762.1.22930 WP_003180762.1.27377 WP_003180762.1.27836 WP_003180762.1.30581 WP_003180762.1.31090 WP_003180762.1.34504 WP_003180762.1.34863 WP_003180762.1.34956 WP_003180762.1.42641 WP_003180762.1.46361 WP_003180762.1.46635 WP_003180762.1.47006 WP_003180762.1.48016 WP_003180762.1.54544 WP_003180762.1.55910 WP_003180762.1.57471 WP_003180762.1.62441 WP_003180762.1.62618 WP_003180762.1.64701 WP_003180762.1.70162 WP_003180762.1.719 WP_003180762.1.7403 WP_003180762.1.74244 WP_003180762.1.8120 WP_003180762.1.85389 WP_003180762.1.8660 WP_003180762.1.86740 WP_003180762.1.86759 WP_003180762.1.94809 WP_003180762.1.95031 WP_003180762.1.9558 WP_003180762.1.98374 WP_003180762.1.99505 gi|52079707|ref|YP_078498.1| 279010.BL01950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]