SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404489007|ref|YP_006713113.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404489007|ref|YP_006713113.1|
Domain Number 1 Region: 186-586
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.82e-94
Family beta-Lactamase/D-ala carboxypeptidase 0.0000059
Further Details:      
 
Domain Number 2 Region: 56-235
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.96e-46
Family Penicillin binding protein dimerisation domain 0.0000359
Further Details:      
 
Domain Number 3 Region: 594-652
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000000419
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.004
Further Details:      
 
Domain Number 4 Region: 654-709
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000106
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404489007|ref|YP_006713113.1|
Sequence length 711
Comment penicillin-binding protein 2B [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MPKKNKFMNRGAAILSICFALFFFVIVGRFAFIQATGKVNGEVLAQKANEQYEKKRTIEA
HRGSILDRNGKVLAEDATTYKLVAIMSEKMKPQYVKDKQLTAEKLAPILGMDEGKVLDIL
NKKGAFQVEFGSAGRDLTYAQKEKIEKLKLPGIVFTRDTKRYYPNGIFASNLIGYSQINE
KTGEMQGMMGLEKTLNDYLKETDGYMTYDTDRTGWRLPNSNEKIKAPNNGDNVYLTIDQK
IQAFLEDSMTTVQKEYKPKKIMAAVVDPKTGKVLAMGQRPSFNPNVRDVTNYYNDLVSYS
FEPGSTMKIFTLAAAIQEGVYNGGEQYKSGSYSVSKKDKPIKDHNGGNGWGPITFNEGVE
RSSNVAFAILANDKLGTDRFNQYLRKFHFYDKTGIDLPGEANSKINFEYLRDKVSTAFGQ
SSAVTPIQQLQAATAIANNGKMMKPYVIDHVVDSDKNKTIYQNKPEQVGQPISAKTAKEV
RELLGKVVTSEKGTGQPYKIEGFDVAGKTGTAQIAGEDGRYLTGRENYVFSFMGMAPKDD
PQLLVYVAVQQPQLKATETGSAPVSKIFNPVMKNSLHYLNITPKETEKEEKQEEKQLKMP
DFSGKRAESAAKEAQGSSLVPVTIGDGLAVKEQYPKAGEAVLPNQRVFLKTDGKITLPDM
TGWSKRDALRFGAMAGIHIETSGQGYVKSQNVKAGKELKANSVVKVRLKNE
Download sequence
Identical sequences A0A1Y0YNB9 Q65JY6
gi|404489007|ref|YP_006713113.1| 279010.BL02236 gi|52080118|ref|YP_078909.1| WP_003181538.1.10695 WP_003181538.1.12567 WP_003181538.1.1290 WP_003181538.1.20727 WP_003181538.1.21456 WP_003181538.1.22930 WP_003181538.1.27377 WP_003181538.1.27603 WP_003181538.1.27836 WP_003181538.1.31090 WP_003181538.1.31877 WP_003181538.1.34504 WP_003181538.1.34863 WP_003181538.1.34956 WP_003181538.1.35764 WP_003181538.1.42641 WP_003181538.1.46361 WP_003181538.1.46635 WP_003181538.1.47006 WP_003181538.1.48016 WP_003181538.1.50447 WP_003181538.1.54544 WP_003181538.1.55910 WP_003181538.1.57471 WP_003181538.1.62441 WP_003181538.1.62618 WP_003181538.1.64701 WP_003181538.1.70162 WP_003181538.1.719 WP_003181538.1.71919 WP_003181538.1.7403 WP_003181538.1.74244 WP_003181538.1.8120 WP_003181538.1.85389 WP_003181538.1.86740 WP_003181538.1.86759 WP_003181538.1.94809 WP_003181538.1.9500 WP_003181538.1.95031 WP_003181538.1.9558 WP_003181538.1.96953 WP_003181538.1.98374 WP_003181538.1.99505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]