SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404489008|ref|YP_006713114.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404489008|ref|YP_006713114.1|
Domain Number 1 Region: 171-565
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.76e-100
Family beta-Lactamase/D-ala carboxypeptidase 0.0000297
Further Details:      
 
Domain Number 2 Region: 52-220
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 9.94e-43
Family Penicillin binding protein dimerisation domain 0.00067
Further Details:      
 
Domain Number 3 Region: 584-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000102
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404489008|ref|YP_006713114.1|
Sequence length 644
Comment stage V sporulation protein SpoVD [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MRVSNVTVRKRLIFVLLFGVIIFLIIDTRLGYVQFVLGDKLTTLAKDSWSRNLPFEPERG
EILDRNGVKLATNQSAPSVLVVPKQVENPIKTSRLLASVLNMSEEKAYKHVTKKTSIERI
NPEGRKISHEKAKEVRDLNLKGVYIAEDSIRHYPFGSYLSHVLGFAGIDNQGLLGLEAFY
DKELKGEKGYVKFYSDAKGKRMPGEADDYTPPKDGLDMKLTIDSKVQTIMEREFDIAEAK
YNPDGMVGVAMNPKNGEILAMVSRPDFDPANYQSIDPKVYNRNLPVWSTYEPGSTFKIIT
LAAALEENKVNLQKDQFYDKGSVEVDGARLKCWKRGGHGAQSFLEVVQNSCNPGFVELGQ
RLGKEKLFTYIKSFGFGQKTGIDLQGEGTGILFPLDRVGPVEQATTAFGQGVSVTPIQQV
TAVSAAVNGGTLYTPYIAKEWIDPVTKQTVKKQTPIAKRKVISEETSKQIRYALESVVAQ
GTGRNAFVDGYRVGGKTGTAQKVKDGKYLKNNHIVSFIGTAPSDDPSIVVYVAVDNPKGT
IQFGGTVAAPIVGNIMRDSLPQLGVKKRKDQIEREYQWLDKKLIEVPNLIGLSVTELEPL
LINLRLKASGEGDVVVQQSPKPGEKVKEGSTIRIYLDSDDGASD
Download sequence
Identical sequences A0A1Y0XLX0 Q65JY5
gi|52080119|ref|YP_078910.1| WP_003181540.1.1290 WP_003181540.1.20727 WP_003181540.1.21456 WP_003181540.1.31090 WP_003181540.1.34863 WP_003181540.1.35764 WP_003181540.1.50447 WP_003181540.1.55910 WP_003181540.1.57471 WP_003181540.1.62618 WP_003181540.1.74244 WP_003181540.1.85389 WP_003181540.1.86759 WP_003181540.1.94809 WP_003181540.1.9500 WP_003181540.1.96953 WP_003181540.1.98374 gi|404489008|ref|YP_006713114.1| 279010.BL02237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]