SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404489016|ref|YP_006713122.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404489016|ref|YP_006713122.1|
Domain Number 1 Region: 20-103
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000022
Family FCH domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404489016|ref|YP_006713122.1|
Sequence length 230
Comment hypothetical protein BLi01742 [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MKRHTVNLSLAMLVLGFLLSFSYQFARENKDHEETAENWKEEYSLRDRLISQEKQNKKLE
QELYKKQQEVQKTETALKKEKKEYYNIVEDVERYRMFVGEIGVQGEGIKVTLKDASYIPE
GENVNNYIVHESHIFRLLNELWISGAAAVSINGQRVTHHSYISCNGPVITVDGNQYPAPF
VISAIGDADVLMPALNIAGGLVDQLSRDHISVSIEKQDNIEMEPLLKQGE
Download sequence
Identical sequences A0A1Y0YNC7 Q65JX7 T5HR51
WP_003181554.1.10695 WP_003181554.1.1290 WP_003181554.1.20727 WP_003181554.1.21456 WP_003181554.1.27377 WP_003181554.1.27603 WP_003181554.1.27836 WP_003181554.1.30581 WP_003181554.1.31090 WP_003181554.1.31877 WP_003181554.1.34504 WP_003181554.1.34863 WP_003181554.1.34956 WP_003181554.1.35726 WP_003181554.1.35764 WP_003181554.1.42641 WP_003181554.1.46361 WP_003181554.1.46635 WP_003181554.1.47006 WP_003181554.1.48016 WP_003181554.1.50447 WP_003181554.1.54544 WP_003181554.1.55910 WP_003181554.1.57471 WP_003181554.1.62441 WP_003181554.1.62618 WP_003181554.1.64701 WP_003181554.1.70162 WP_003181554.1.719 WP_003181554.1.71919 WP_003181554.1.7403 WP_003181554.1.74244 WP_003181554.1.8120 WP_003181554.1.85389 WP_003181554.1.86740 WP_003181554.1.86759 WP_003181554.1.94809 WP_003181554.1.9500 WP_003181554.1.95031 WP_003181554.1.9558 WP_003181554.1.96953 WP_003181554.1.98374 WP_003181554.1.99505 gi|52080127|ref|YP_078918.1| 279010.BL02246 gi|404489016|ref|YP_006713122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]