SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404490179|ref|YP_006714285.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404490179|ref|YP_006714285.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 1.01e-46
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 162-315
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.78e-37
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00025
Further Details:      
 
Domain Number 3 Region: 318-420
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 6.93e-18
Family Glutamyl tRNA-reductase dimerization domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404490179|ref|YP_006714285.1|
Sequence length 453
Comment glutamyl-tRNA reductase [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MHILVVGLDYKSAPVDIREKLTFQPDELGQAMAQLKEEKSILENIIVSTCNRTELYAVVD
QLHTGRYYMKMFLANWFGLSKEDISPYLKFYENDGAVEHLFRVSCGLDSMVIGETQILGQ
VRTSFKLAQEEKTIGTVFNYLFKQAVTVAKRCHAETDIASNAVSVSYAAVELARKIFGDL
SDKHVLILGAGKMGELAVQNLHGHGIGQVTVINRTFSKAKELAGRFSGAAKSLNELQCAL
MEADILISSTGASGYVVTKEMIEHVNKLRKGCPLFMVDIAVPRDLDPALSEVEGVFLYDI
DDLEGIVEENLKERQAVAEEVELIIEAEIVSFKQWLNTLGVVPVISALREKALTIQAETM
QSIERKLPHLSTREKKLLNKHTKSIINQLLRDPILKVKEFASEADAEEKLALFTQIFDIE
EAAFPDGERQDERQPVHAFKRQNPQGLTSIASE
Download sequence
Identical sequences A0A2A5Z8Y5 Q65GJ9
gi|52081300|ref|YP_080091.1| gi|404490179|ref|YP_006714285.1| WP_009329306.1.1290 WP_009329306.1.20727 WP_009329306.1.31090 WP_009329306.1.50447 WP_009329306.1.55910 WP_009329306.1.64701 WP_009329306.1.74244 WP_009329306.1.8660 WP_009329306.1.86759 WP_009329306.1.9500 WP_009329306.1.96953 279010.BL00623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]